KEGG   T30241 (Metagenome): 4868
Entry
4868              CDS       T30241                                 

Gene name
ribB
Definition
3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Best hit
nme:NMB1256 (best score: 415.231)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00740  Riboflavin metabolism
00790  Folate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.4868-T1-C
LinkDB
Position
C165828:complement(269..892)
AA seq 207 aa
LIPASVICEIINDDGTMARMPELMKFAEEHKLKIGTIADLIEYRSRTESLLEDMGNAPVQ
TPWGEFQQHVYVDKLSGETHLALVKGTPAADTETLVRVHEPFSVMDFIQANPRHSWSLPK
ALEHIQQAESGVVILLHRTEDGASLLDRTLPKGANQAYKWDSKSYGIGAQILAGLNVKKL
RVLGQPSSFTGLTGFGLEVVGFEEAEK

KEGG   T30241 (Metagenome): 6674
Entry
6674              CDS       T30241                                 

Gene name
ribB
Definition
3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Best hit
fnu:FN1508 (best score: 597.43)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
00790  Folate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.6674-T1-C
LinkDB
Position
C168134:798..1733
AA seq 312 aa
MIYKIEDVLEDIKNGIPLIIVDDENRENEGDLFVAAEKATYESVNLMATYARGLTCTPMS
TEYAVRLGLDPMTARNTDAKCTAFTVSVDAKEGTTTGISIADRLTTIKKLSDINSVPSDF
TRPGHIFPLIAKDRGVLEREGHTEATVDLCKICGLTPVAVICEILKDDGTMARVPDLEIF
AKKHNLKIITIADLIKYRKKTEQLMKIDVVANMPTDSGTFKIVGFDNLIDGKEHIALVKG
DVAGKENVTVRIHSECFTGDILGSLRCDCGSQLKTAMRRIDRLGEGIVLYLRQEGRGIGL
LNKLRAYNLQEE

KEGG   T30241 (Metagenome): 7657
Entry
7657              CDS       T30241                                 

Gene name
ribA
Definition
GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Best hit
pru:PRU_1913 (best score: 697.582)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00740  Riboflavin metabolism
00790  Folate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.7657-T1-C
LinkDB
Position
C169071:complement(1294..2490)
AA seq 398 aa
ELSSIEDAVKDFKEGKFVIVVDDEDRENEGDLIMAAEMITPEKVNFMLKNARGVLCVPIT
LSRAKELDLPHQVTDNTSVLGTPFTVTVDKLEGCSTGVSTHDRAETIKALADPNSTPQTF
GRPGHINPLYAQDNGVLRRSGHTEAAIDLCKMAGCFPAGVLMEIMNDDGTMARMPQLIEK
AKEWDMKIISIKDIIAYRLKRETSIEVGVEVDMPTRYGHFRLIPFRQTSTGVEHMALIKG
EWREDEPVLVRVHSSCATGDILGSERCDCGEQLHKAMEMIEEEGKGVLIYMQQEGRGIGL
MNKMAAYKLQEQGLDTVDANLHLGFKPDERDYGCGAQMLRHLGVHKMRLMTNNPTKRVGL
EAYGLEIQENIPIEVRPNEYDYRYLKTKKDRMGHDLHL

KEGG   T30241 (Metagenome): 4918
Entry
4918              CDS       T30241                                 

Gene name
ribB
Definition
3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Best hit
ecor:SAMEA4412678_1611 (best score: 367.081)
Taxonomy
Betaproteobacteria [GN:ecor]
Pathway
00740  Riboflavin metabolism
00790  Folate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.4918-T1-C
LinkDB
Position
C165900:complement(2..736)
AA seq 245 aa
MTDTAGLRRHNLRQWIEKYYGGLQTRFAEAVALNTGELSALLKNKSFGEKKARKIEQAAK
MPAFWLDTEHTARPSEHTGKHTMSHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAA
QFVTPEAINFMIKHARGLVCLPMDGEMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGITT
GISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQKGGVLVRAGHTEAGVDLAQMNGLI
PASVI

KEGG   T30241 (Metagenome): 4792
Entry
4792              CDS       T30241                                 

Gene name
ribBA
Definition
riboflavin biosynthesis protein ribBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Best hit
fnu:FN1508 (best score: 172.17)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
00790  Folate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.4792-T1-C
LinkDB
Position
C165724:3..287
AA seq 94 aa
AYNLQEEGMDTLDANLHLGFGADMRDYAVAAQMLKALGVKSIKLLTNNPLKINGLEEYGM
PVVEREEIEIEANKINKIYLKTKKERMGHLLKIK

DBGET integrated database retrieval system