KEGG   T30241 (Metagenome): 4929
Entry
4929              CDS       T30241                                 

Definition
dTMP kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Best hit
fnu:FN1323 (best score: 443.351)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4929-T1-C
LinkDB
Position
C165916:135..821
AA seq 228 aa
MGKIIVIEGTDSSGKETQTKLLYERVKKIYDKTIRISFPNYDSPACEPVKMYLAGAFGTD
ATKVNPYPISTMYAIDRYASFKQDWEKKYIDDYVIITDRYVTSNMIHQASKIKNNEEKEE
YLRWLVDLEYNKNKIPEPDIVIFLKMPIDKAKELMENRKNKIDGSEKKDIHEVNEDYLKK
SYENATAISKKYNWCEIECVENNKIKSIEKINDEIFFKIKEIIQYNEK

KEGG   T30241 (Metagenome): 9635
Entry
9635              CDS       T30241                                 

Gene name
tmk
Definition
dTMP kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Best hit
nme:NMB0670 (best score: 402.134)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.9635-T1-C
LinkDB
Position
C170233:complement(1585..2205)
AA seq 206 aa
MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKA
GLRAETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEH
WVQGGLRPDLTLLLDVPLEVSMARIGQTREKDRFEQEQADFFMRVRSVYLDRAAACPERY
AVIDSNLGLDEVRNSIEKVLDRHFGC

DBGET integrated database retrieval system