KEGG   T30241 (Metagenome): 516
Entry
516               CDS       T30241                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
nme:NMB1661 (best score: 395.201)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.516-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_512:complement(137..754)
AA seq 205 aa
MSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEANGVHYHFVSK
EEFESLIAQEAFLEYADVFGNYYGTGAEGVNALAAAGYDVILEIDVQGAAQVRDALPEAV
GIFILPPSFDVLAARLNGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDDLARAEEDL
RHIVNACRLKRSRQLGFIADLLENS

KEGG   T30241 (Metagenome): 572
Entry
572               CDS       T30241                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
fnu:FN2033 (best score: 357.451)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.572-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_539:complement(1205..1762)
AA seq 185 aa
MSLGALYVVSGPSGAGKSTVCKLVRERLGINLSISATSRKPRNGEQEGVDYFFITAEEFE
RKIKNDEFLEYANVHGNYYGTLKSEVEERLKRGEKVLLEIDVQGGLQVKNKFPEANLIFF
KTANKEELEKRLRGRNTDSEEVIQARLKNSLKELEYEDRYDRVIINNEIEQACNDLISII
ENGVR

KEGG   T30241 (Metagenome): 9429
Entry
9429              CDS       T30241                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
pru:PRU_2547 (best score: 279.641)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.9429-T1-C
LinkDB
Position
C170159:complement(5307..5879)
AA seq 190 aa
MQGKLIIFSAPSGAGKSTIVQWLMNEHPELKLAFSISCTTRAPRGTERDGVEYIFLSPEA
FKKRIEDNDFLEYEEVYTDRFYGTLKSQVEAQADKGQNVIFDVDVKGGCNIKQFYGEKAL
SLFVQPPSIAELRRRLEGRQTDSADAIESRIAKAEYELTFADKFDHIIVNDDLAKAKEEA
YNIIKQFIEA

DBGET integrated database retrieval system