KEGG   T30241 (Metagenome): 5541
Entry
5541              CDS       T30241                                 

Definition
succinate dehydrogenase
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Best hit
fnu:FN0050 (best score: 465.692)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
02020  Two-component system
Other DBs
HMP: SRS015062.5541-T1-C
LinkDB
Position
C166780:248..1132
AA seq 295 aa
VEETMKKNFFGKLFGLTILMFTLLFTGAFAEVYEGTGLGYDKDGIVLDVEITNNKIVDVK
VKRAKESEFATPAIQEIAKKVIATQSLDVDGISGATITSEGTKEAIEEAVKKSGITLTAV
TGQNTKAVELLKEADVVVIGAGGAGLTSAIAAHEKGVKVILIEKTELLGGNTNYATAGLN
AAGTKIQEKLGIKDSPELFYEDTIKGGKNKNNKELVKVLANNSSAIVDWLIERGADLSEL
TSTGGQSAKRTHRPTGGTAVGPNIVAALSKTAESEKIDIRKGTKAIALVKAKNKI

KEGG   T30241 (Metagenome): 3468
Entry
3468              CDS       T30241                                 

Definition
fumarate reductase, flavoprotein subunit
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Best hit
fnu:FN0050 (best score: 341.273)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
02020  Two-component system
Other DBs
HMP: SRS015062.3468-T1-C
LinkDB
Position
C163532:complement(1..558)
AA seq 186 aa
KAIALVKAKNKIVGVKVREVDGKEYTIKAKAVIVATGGFGANAKMVEKYNPKLKGFGSTN
NPAIVGDGIIMVEKVGGALVDMNEIQTHPTVVHNKTNMITEAVRGEGAILVNRDGKRFID
ELETRDVVSKAILSQKGKSAFLIFDEDIRTKLKAADGYVKKGFAVEGTLEEIAAKIGTDA
KTLEAT

KEGG   T30241 (Metagenome): 2191
Entry
2191              CDS       T30241                                 

Gene name
frdB
Definition
fumarate reductase iron-sulfur subunit
  KO
K00245  fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Best hit
hin:HI0834 (best score: 143.28)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
02020  Two-component system
Other DBs
HMP: SRS015062.2191-T1-C
LinkDB
Position
C161064:complement(179..379)
AA seq 66 aa
YNLDNRDHGKAKRMSLLNGKNGVWSCTFVGYCSEVCPKHVDPASAINQGKVESAKDYVIS
MLKPKG

KEGG   T30241 (Metagenome): 2190
Entry
2190              CDS       T30241                                 

Gene name
frdC
Definition
fumarate reductase subunit C
  KO
K00246  fumarate reductase subunit C
Best hit
hin:HI0833 (best score: 118.242)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
02020  Two-component system
Other DBs
HMP: SRS015062.2190-T1-C
LinkDB
Position
C161064:complement(1..168)
AA seq 56 aa
MSVTVSKRKKYVRPMTATWWQKLDFYKAYMLREATSVFAVWFCIVLLYGVLCLASN

DBGET integrated database retrieval system