KEGG   T30241 (Metagenome): 5791
Entry
5791              CDS       T30241                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
bhu:bhn_I2424 (best score: 184.882)
Taxonomy
Firmicutes - Clostridia [GN:bhu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.5791-T1-C
LinkDB
Position
C167122:complement(457..1251)
AA seq 264 aa
VDITLISPEDAKHDKDDSRFGFSAENEEFEQALKKIKSISNVTLNGLHIHRTSRTRSINF
YRNLVKYSIDIISKYQLSLNYIDIGGGYFGIFDNKPTYNDYCATISEVFENQQSKDLLRK
TTIIVEPGNALTASVFDYHTSVIDCKKVGNKVFITTDGTRNDIDPLFQKQDYIKEIIYKE
KNNGNITKQIVSGCTCLEFDRLFELTNSPQLNIGDKICYKNVGAYTMCLSPLFIRYIPKV
YSKTTKELLREEWGATEYVAQCKM

KEGG   T30241 (Metagenome): 7617
Entry
7617              CDS       T30241                                 

Definition
pyridoxal-dependent decarboxylase, pyridoxal binding domain protein
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
osp:Odosp_0123 (best score: 124.02)
Taxonomy
Bacteroidetes [GN:osp]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.7617-T1-C
LinkDB
Position
C169037:2040..2456
AA seq 139 aa
MISMDTINMQTPYFLLDEEDFVKNTTSFQNALKKYFKKSIIGFSVKTNSFPYLLKIAREQ
GCYAEVVSYTEYELALLCGFPKNRIIYNGPMKSKGTFIDALENGAIVNIETKREIEWLNS
LNASKHYNIGIRLNVDITL

KEGG   T30241 (Metagenome): 9610
Entry
9610              CDS       T30241                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
nme:NMB1976 (best score: 786.563)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.9610-T1-C
LinkDB
Position
C170225:complement(1901..3121)
AA seq 406 aa
MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSII
KHFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIP
EIDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQ
PNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQDEN
VPDLGAYAQAVQKLIGTRPLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN
DLMRPALYDAYHHIEAVETKDIEPLTANIVGPICETGDFLGKDRTIACEEGDLLLIRSAG
AYGASMASNYNARNRAAEVLVDGGGYRLIRRRETLEQQMANELACL

DBGET integrated database retrieval system