KEGG   T30241 (Metagenome): 6170
Entry
6170              CDS       T30241                                 

Definition
oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Best hit
fnu:FN1376 (best score: 577.4)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.6170-T1-C
LinkDB
Position
C167582:1..915
AA seq 304 aa
YTISPVHTIEYFKNLALEMQEIGADSIAIKDMSGILLPEVAYELVKELKSVLRVPVEVHT
HATAGLASMTYIKAVEAGADIIDTAISPLSGGTSQPATESIVRAFQGTERETGFDLGLLK
EIAEYFKPIRAKYLQEGILNPQALMTEPSIVEYQLPGGMLSNFLSQLKMQKAENRYEDVL
REIPRVRKDLGYPPLVTPLSQMVGTQAIFNILTGQRYKLIPNEIKNYVRGLYGKSPVPIS
DEIKKTIIFDEEVFTGRPADKLAPEYDKMVEETRDFARSEEDVLSYALFPQVAKDFLIKK
YENE

KEGG   T30241 (Metagenome): 7066
Entry
7066              CDS       T30241                                 

Definition
oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Best hit
fnu:FN1376 (best score: 273.092)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.7066-T1-C
LinkDB
Position
C168525:complement(3..413)
AA seq 137 aa
METCLRDGHQSLMATRLTTAEMLPIIEKLDNVGYHSLEMWGGATFDAALRFLNEDPWERL
REIKKRVKNTKLQMLLRGQNLLGYRNYPDDIVERFVKKSIQNGIDIVRIFDALNDVRNLQ
TACEATKKYGGHAQLAM

KEGG   T30241 (Metagenome): 5167
Entry
5167              CDS       T30241                                 

Definition
sodium ion-translocating decarboxylase, beta subunit
  KO
K20509  carboxybiotin decarboxylase [EC:7.2.4.1]
Best hit
fnu:FN0201 (best score: 572.392)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00362  Benzoate degradation
00620  Pyruvate metabolism
00650  Butanoate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS015062.5167-T1-C
LinkDB
Position
C166250:complement(1..960)
AA seq 320 aa
MSFFSVLSELLEASGFAALTWQNIAMILVSFVLFYLAIVKKFEPLLLLPISFGMFLVNLP
LAGLMDEGGVINIMSYGVKSNLFPCLVFMGVGAMTDFSPLIANPISLILGAAAQLGIYVA
FIFATQIGFTPAEAAAIGIIGGADGPTSIYIANNLAPHLLAPIAVAAYSYMALIPLIQPP
IMKALTTKKERAVKMGQLRKVSKTEKIVFPIAVVLFTSLLLPSVAPLLGLLMLGNLFRES
GVVQRLSDTAQNAMINIITIMLGLSVGAKADGATFLDVSTLKIIAMGLAAFCFSTAGGVL
LGKLLYIITGGKINPLIGSA

DBGET integrated database retrieval system