KEGG   T30241 (Metagenome): 6623
Entry
6623              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
nme:NMB0435 (best score: 791.186)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6623-T1-C
LinkDB
Position
C168078:complement(260..1459)
AA seq 399 aa
MSDQLILVLNCGSSSLKGAVIDRKSGSVVLSCLGERLTTPEAVITFNKDGNKRQVPLSGR
NCHAGAVGMLLNELEKHGLHDRIKAIGHRIAHGGEKYSESVLIDQAVMDELNACIPLAPL
RNPANISGILAAQEHFPGLPNVGVMDTSFHQTMPERAYTYAVPRELRKKYAFRRYGFHGT
SMRYVAPEAARILGKPLEDIRMIIAHLGNGASITAIKNGKSVDTSMGFTPIEGLVMGTRC
GDIDPGVYSYLTSHAGMDVAQVDEMLNKKSGLLGISELSNDCRTLEIAADEGHEGARLAL
EVMTYRLAKYIASMAVGCGGVDALVFTGGIGENSRNIRAKTVSYLDFLGLHIDTKANMEK
RYGNSGIISPTDSSPAVLVVPTNEELMIACDTAELAGIL

KEGG   T30241 (Metagenome): 6883
Entry
6883              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
alq:C7Y71_011400 mana:MAMMFC1_03946 (best score: 58.5362)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6883-T1-C
LinkDB
Position
C168346:1768..1869
AA seq 34 aa
MKILVLNCGSSSIKYKLYDMADESVLAQGGAERV

KEGG   T30241 (Metagenome): 5970
Entry
5970              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
pru:PRU_2259 (best score: 499.204)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5970-T1-C
LinkDB
Position
C167332:1..1119
AA seq 372 aa
GAERVGLDEAFVKVTLKDGSKEKIMHDMPDHKEGVKFVFQLLLDPKYGALKSLDEIDAVG
HRIVQGGDLFEKSCIVTEEVEKGIESLIDLAPVHNLGHLRGLKAVDALMPHTPQVTVFDN
AFHSTMPPHAYLYAVPYEMYEKYHVRRYGFHGTSHRYVSKRACEFLGVDYKSQKIITCHI
GNGASMAAIKDGKVIDTSMGLTPLAGMMMGSRCGDIDASAVTYMMEKLGKTPQEMADYLN
KESGVLGITGISSDMREIEAAEAAGDERAILALKMYTYRIKKYIGAYAAAMGGVDVIVWT
AGVGENQTGLRMDSCAGLEFLGIKMDAEKNNCRGVERILSTDDSKVKVVLIPTDEEIVIA
RDTQELVLEAKK

KEGG   T30241 (Metagenome): 9448
Entry
9448              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
nme:NMB1518 (best score: 760.37)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.9448-T1-C
LinkDB
Position
C170165:3950..5146
AA seq 398 aa
MSQKLILVLNCGSSSLKGAVLDNGSGEVLLSCLAEKLNLPDAYITFKVNGEKHKVDLSAH
PDHTGAVEALMEELKAHGLDSRIGAIGHRVVSGGELYSESILVDDEVIAGIEKCIPLAPL
HNPAHLLGLRAAQSIFKGLPNVVVFDTSFHQTMPEVAYKYAVPQELYEKYGLRRYGAHGT
SYRFVADETARFLGKDKKDLRMVIAHLGNGASITAVANGESRDTSMGLTPLEGLVMGTRS
GDIDPSVFGFLAENANMTIAQITEMLNKKSGLLGISGLSNDCRTIEEEAAKGHKGAKLAL
DMFIYRLAKYIGSMAVAAGGLDALVFTGGIGENSDIIRERVIGYLGFLGLNIDQEANLKA
RFGNAGVITTADSKAVAVVIPTNEELMIAHDTARLSGL

KEGG   T30241 (Metagenome): 5292
Entry
5292              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
fnu:FN1171 (best score: 394.43)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5292-T1-C
LinkDB
Position
C166424:1..615
AA seq 204 aa
IMGNPEHSKIIVCHLGNGASITAVKDGKSVDTSMGLTPLQGLMMGTRCGDIDPAAVLFVK
NKRGLTDAQMDERMNKKSGILGLFGKSSDCRDMENAVKEGDERAILAESVSMHRLRSYIG
AYAAVMGGVDAICFTGGIGENSSMTREKALEGLEFLGVELDKEINSVRKKGNVKLSKESS
KVLVYKIPTNEELVIARDTFRLAK

KEGG   T30241 (Metagenome): 3694
Entry
3694              CDS       T30241                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
fnu:FN1171 (best score: 385.185)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.3694-T1-C
LinkDB
Position
C163938:16..597
AA seq 194 aa
MKILVINCGSSSLKYQLINPETEEVFAKGLCERIGIDGSKMEYEVIAKDFEKKLETPMPS
HKEALELVISHLTDKEIGVIASVDEVDAIGHRVVHGGEEFAQSVLVNEAVLKAIEVNNDL
APLHNPANLMGIRTCMELMPGKKNVAVFDTAFHQTMKPEAFIYPLPYEDYKELKVRKYGF
HGTSHLYVSGIMRE

DBGET integrated database retrieval system