KEGG   T30241 (Metagenome): 6661
Entry
6661              CDS       T30241                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
fnu:FN0409 (best score: 198.749)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.6661-T1-C
LinkDB
Position
C168124:3..341
AA seq 112 aa
GLGVADKVFMLENSVYSVISPEGCAAILYKDPNRVEEAANNLKLSSHSLLKIGLIDGIID
EALGGAHRGPEDTAFNLKKVVLEAVEELEKIPVDELVEKRYEKFRQMGVFNR

KEGG   T30241 (Metagenome): 8267
Entry
8267              CDS       T30241                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
nme:NMB1139 nme:NMB1177 (best score: 608.986)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.8267-T1-C
LinkDB
Position
C169533:482..1441
AA seq 319 aa
MKPVFLDFEQPIAELTNKIDELRFVQDESAVDISDEIHRLQKKSNDLTKSIFSKLTPAQI
SQVSRHPQRPYTLDYIEALFTDFEELHGDRHFADDYAIVGGLARFNGQSVMVVGHQKGRD
TKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFIDTPGAYPGIGAEERGQSEAIGK
NLYELTRLRVPVLCTVIGEGGSGGALAVAVGDYVNMLQYSTYSVISPEGCASILWKTAEK
AADAAQALGITADRLQKLDLVDTVIKEPLGGAHRDFGQTMKNVKAVLEKQLHEAQSIPLA
DLLSRRFDRIMAYGKFSEQ

KEGG   T30241 (Metagenome): 3186
Entry
3186              CDS       T30241                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
fnu:FN0409 (best score: 305.064)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.3186-T1-C
LinkDB
Position
C163018:complement(1..504)
AA seq 168 aa
DQRDIALKVLYDDLTDYQRVMVSRHPERPYTLDYIKYITTDFVELHGDRLFRDDPAIVGG
LCKIDGKNFMIIGHQKGRTMQEKVFRNFGMANPEGYRKALRLYEMAGRFKLPILTFIDTP
GAYPGLEAEKHGQGEAIARNLMEMSGIKTPIVSVVIGEGGSGGALGLG

KEGG   T30241 (Metagenome): 6806
Entry
6806              CDS       T30241                                 

Gene name
accB
Definition
acetyl-coA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
nme:NMB1860 (best score: 154.451)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.6806-T1-C
LinkDB
Position
C168270:complement(1586..1816)
AA seq 76 aa
DAQKSPMVGTFYRAPGPNAAPFVEVGQQVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILV
ENGTPVEFGEPLFIIG

KEGG   T30241 (Metagenome): 6538
Entry
6538              CDS       T30241                                 

Definition
acetyl-coA carboxylase, biotin carboxyl carrier protein (fragment)
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
nme:NMB1860 (best score: 70.0922)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.6538-T1-C
LinkDB
Position
C168002:complement(1..147)
AA seq 49 aa
MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAPVYAAPVPAA

KEGG   T30241 (Metagenome): 6805
Entry
6805              CDS       T30241                                 

Gene name
accC
Definition
acetyl-coA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
nme:NMB1861 (best score: 900.968)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.6805-T1-C
LinkDB
Position
C168270:complement(111..1472)
AA seq 453 aa
MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKDSLHVKLADESVCIGPAASAQSY
LNVPAIIAAAEVSCADAVHPGYGFLAENADFAEQVEQSGFTFIGPKPDTIRLMGDKVSAK
HAMIAAGVPCVPGSDGALPDDGEEILKIADKVGYPVIIKASGGGGGRGMRVVEKKEDLLQ
SVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVIADEHGNAIYLAERDCSLQRRHQKVI
EEAPAPFITEKERAKIGNACADACKRIGYRGAGTFEFLYEDGEFFFIEMNTRVQVEHPVT
ELITGVDIVQEQLRIAAGLPLQYKQKDIQVEGHAFECRINAEDPYNFIPSPGPIESCHLP
GGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAMAKMRVALAELAVTGIKTNTPL
HRDLFADAGFQKGGVSIHYLEHWLEDRKAKQDK

KEGG   T30241 (Metagenome): 5578
Entry
5578              CDS       T30241                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
fnu:FN0408 (best score: 586.26)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.5578-T1-C
LinkDB
Position
C166842:complement(99..1013)
AA seq 304 aa
MSILKNLVKNLGLTNITQPKKKYATVGEKKSDEEKERAKYEVKNIDNLKEDEVTKCPSCG
VLSHKSEIRANMKMCPNCNHYFNMSARERIELLIDEGTFKEEDATLTSANPINFPEYAEK
IEKAQHDSGMNEGVISGIGEINGLKVSIACMDFNFMGGSMGSVVGEKITAALERAIEHKI
PAVVVAISGGARMQEGLTSLMQMAKTSAAVKKMRLAGLPFISVPVNPTTGGVTASFAMLG
DIIISEPKARIGFAGPRVIEQTIRQKLPENFQKSEFLQECGMVDVIAKREDLKATIYKVL
NDII

KEGG   T30241 (Metagenome): 8896
Entry
8896              CDS       T30241                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
nme:NMB0679 (best score: 569.696)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS015062.8896-T1-C
LinkDB
Position
C169921:complement(2035..2907)
AA seq 290 aa
MSWLDKILPPKIKNRSKDGSSNVPEGLWHKCPSCSATVYSTELQQNNQVCPKCNHHNPLS
ARQRLNLLLDEDGREEVAGNVKPIDPLKFKDSKKYPDRLGAARKLTGEDDALVVMKGMMN
GLPVVVAAFEFRFIGGSMGSVVGERFVQGVRRAVADNCPFVCVAASGGARMQEGVNSLMQ
MTKTSAALHLLTEKRLPFISVLTDPTMGGVSASFAFLGDVVLAEPNALIGFAGPRVIEQT
VRETLPEGFQRAEFLLEKGAIDQIVDRRDMKRRISDLITLLCRQDKVSAA

DBGET integrated database retrieval system