KEGG   T30241 (Metagenome): 6817
Entry
6817              CDS       T30241                                 

Gene name
ribF
Definition
riboflavin biosynthesis protein ribF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Best hit
pdi:BDI_3100 (best score: 249.21)
Taxonomy
Bacteroidetes [GN:pdi]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.6817-T1-C
LinkDB
Position
C168284:complement(1031..1828)
AA seq 265 aa
ESMVITFDRHPRQVLQSDYQPKMLSTLDEKLEKLEQTATDHIVVLHFDKALSQLTSKQFM
ETVLHKQLNVCKLMMGYDNRFGHNRTETFDDYVLFGKEIGIEVFQNTALSMGDFNVSSSV
IRRFIEAGNMEEATRCLGIPYSLRGKVVGGYRNGRKLGYPTANINICETEKLLPGMGVYA
VRVRIANDEKEYGGMLNIGTRPTFNGTDLSVEVHIFDFSDNLYDQTIQVRFISRVRSDRK
FPTLDALAEQMQLDEQQIRTILEKQ

KEGG   T30241 (Metagenome): 8791
Entry
8791              CDS       T30241                                 

Gene name
ribF
Definition
riboflavin biosynthesis protein ribF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Best hit
nme:NMB1834 (best score: 603.979)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.8791-T1-C
LinkDB
Position
C169861:complement(3058..4014)
AA seq 318 aa
MTACFTTYPNATMRIRLGRHNAPDFPHGAAVTIGNFDGVHLGHKHILQKLRLEADTRGLP
VVTVVFEPQPKEFFALRTGRMPPCRISPLRTKLELLEGTGCVDAVWVLRFDQNFSEISAQ
GFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQTERTPSVIVEDIRTSSTA
VRQALSDGNLAYAKKLLGHDYVLSGRVVHGRKLGRTLNAPTANIRLPRHRYALGGVFVVE
ADGAFGTRRGVASFGFNPTVDSGCSQKLEVHLFDFQGDLYGQRLNVRFLHKLRDEEKFDG
MAELKRQIAADMEAAKCW

KEGG   T30241 (Metagenome): 522
Entry
522               CDS       T30241                                 

Definition
riboflavin biosynthesis protein ribF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Best hit
bth:BT_2543 (best score: 51.2174)
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.522-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_515:complement(2..160)
AA seq 53 aa
MKTIFLKDINTDKLRFEKPSVATIGFFDGVHLGHQFLINRLAEMAKQDGLESM

KEGG   T30241 (Metagenome): 4831
Entry
4831              CDS       T30241                                 

Definition
riboflavin kinase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Best hit
fnu:FN0707 (best score: 447.973)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.4831-T1-C
LinkDB
Position
C165782:3..695
AA seq 230 aa
VMQKVDKNFLEYTPLEFVRILKNKLKVKEIFIGFNFSFGKGGVGKAEDLEYLAEIHNIKV
TELPPVTLDGELVSSSAIRKKIANSDFEGAVKFLDHPMLVIGEVIHGKKIARELGFPTTN
IKMDNRLYPPFGIYGAFLQVGDKNSKVLYGVVNVGYNPTLKQEISLEVHILDFNREVYGE
KVYIQIVKFMRKEKKFSSIDELKATIQADVDRWKLFKREMKYGRSCSKTQ

KEGG   T30241 (Metagenome): 3858
Entry
3858              CDS       T30241                                 

Definition
riboflavin kinase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Best hit
fnu:FN0707 (best score: 187.578)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.3858-T1-C
LinkDB
Position
C164210:complement(2..286)
AA seq 95 aa
MIVVNDILTTNIDFNDTYVAIGNFDGVHYGHKKLINETIKAARENGKQAVVFTFANHPME
VLFPERKFDYINTNEEKLYLLESLGVDVVVMQKVD

DBGET integrated database retrieval system