KEGG   T30241 (Metagenome): 7202
Entry
7202              CDS       T30241                                 

Definition
ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Best hit
nme:NMB2053 (best score: 58.151)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
HMP: SRS015062.7202-T1-C
LinkDB
Position
C168649:1998..2078
AA seq 27 aa
MDNQEINNGRRRFLTLATCGAGGVAAL

KEGG   T30241 (Metagenome): 8305
Entry
8305              CDS       T30241                                 

Gene name
petA
Definition
ubiquinol-cytochrome c reductase, iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Best hit
nme:NMB2053 (best score: 324.709)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
HMP: SRS015062.8305-T1-C
LinkDB
Position
C169553:3..491
AA seq 162 aa
PFVASFFPSEKAKAAGAAVEVDVSKIEAGQLLTAEWQGKPIWVLNRTDQQLKDLKGLNGE
LTDPNSDAEQQPEYAKNETRSIKPNILVAIGICTHLGCSPTFRPDIAPADLGADWKGGFF
CPCHGSKFDLAGRVYKGVPAPTNLVVPPYKYLSDTTILVGED

DBGET integrated database retrieval system