KEGG   T30241 (Metagenome): 7314
Entry
7314              CDS       T30241                                 

Definition
lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Best hit
fnu:FN0356 (best score: 250.366)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.7314-T1-C
LinkDB
Position
C168747:complement(1761..2132)
AA seq 123 aa
MKFHFLHENFNVLDLEKSIKFYNEALGLKVVREKFAEDGSYKIIYLGDDITHFQLELTWL
ADRTEKYDLGDEEFHLAFEVDNYKEAFKKHTEMGCVVFVNEKMGIYFITDPDGYWLEILP
SKK

KEGG   T30241 (Metagenome): 561
Entry
561               CDS       T30241                                 

Definition
hypothetical protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Best hit
pce:PECL_1511 (best score: 146.362)
Taxonomy
Firmicutes - Bacilli [GN:pce]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.561-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_535:626..1009
AA seq 127 aa
MRIEHLAIWADNIELLRNFYMKYFDMQSNEMYTNEKKGFHSYFLSWKGENSRIEIMSQAG
KIESLPNKMKGLAHFAIALGSEERVLQLTEQLREDGYKVFSEPRYTGDGYFESVIGDPEG
NYVELTV

KEGG   T30241 (Metagenome): 8696
Entry
8696              CDS       T30241                                 

Gene name
gloA
Definition
lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Best hit
nme:NMB0340 (best score: 273.092)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.8696-T1-C
LinkDB
Position
C169797:2898..3296
AA seq 132 aa
MLRVGNLEKSLDFYQNVLGMKLLRRKDYPEGRFTLAFVGYGDETDSTVLELTHNWDTERY
DLGNAYGHIAVEVDDAYEACERVKRQGGNVVREAGPMKHGTTVIAFVEDPDGYKIEFIQK
KSGDDSVAYQTA

KEGG   T30241 (Metagenome): 4107
Entry
4107              CDS       T30241                                 

Definition
glyoxalase family protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Best hit
fnu:FN1050 (best score: 246.899)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00620  Pyruvate metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS015062.4107-T1-C
LinkDB
Position
C164640:complement(162..545)
AA seq 127 aa
MFIEHIAMYVNDLEKTKKFFIKYLGAKSNSIYHNKKTDFKSYFLTFDSGCRLEIMTKPEL
VDDKKDLKRTGFIHIAFSVGSKEKVDELTEILKADGYEVISGPRTTGDGYYESCIVAIEE
NQIEITI

DBGET integrated database retrieval system