KEGG   T30241 (Metagenome): 7501
Entry
7501              CDS       T30241                                 

Definition
HMGL-like protein
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Best hit
pru:PRU_0254 (best score: 683.715)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.7501-T1-C
LinkDB
Position
C168931:complement(987..2336)
AA seq 449 aa
AALCITTSPVHTLEYYCELADKEIEAGAEEICLKDMAGIGQPAFLGKLTKMIKDKHPEII
IEYHGHSGPGLSMASMLEVAKNGADILDVAIEPLSWGMVHSDLISVQSMLKNAGFDVPEI
NMDAYMKARAMTQEFIDEWLGYFINPKNKISSSLLLGCGLPGGMMGSMMADLGGIHATIN
NLRKKKGEAELSLDDMLVKLFDEVAYVWPRVGYPPLVTPFSQYTKNIALMNLLTIEQGKG
RFVMMDDSMWGMILGKSGKVPGKIDDEIVELAKQKGLEFTDADPHTLLPNALDDFRKEMD
ENGWDYGQDDEELFELAMHPEQYRNYKSGQAKKNFLADLQKAKDAKLGDKVSIEEATAFK
HAKADAIVSPVKGQVFWEFQGDGEAAPSVEPFIGKEYKEGEKFCYILAPWGEFVEIPAAL
GGKLVEINAKQGSKINKGDVIAYIQRDEK

KEGG   T30241 (Metagenome): 4325
Entry
4325              CDS       T30241                                 

Definition
HMGL-like protein
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Best hit
pru:PRU_0254 (best score: 235.728)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015062.4325-T1-C
LinkDB
Position
C165018:complement(3..491)
AA seq 163 aa
LSKFAHCNAPAHYICEQEKRKVLKIDMAKKIQFSLIYRDMWQSSGKFQPRKDQLVRIAPI
FVEMGCFARVETNGGAFEQVNLLAGENPNESVRAYTKILHDAGIQTHMLDRGLNALRMYP
VPDDVRALMYKVKHAQGVDIPRIFDGLNDIRNIAPSIKWAKEA

DBGET integrated database retrieval system