KEGG   T30241 (Metagenome): 8306
Entry
8306              CDS       T30241                                 

Gene name
petB
Definition
cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Best hit
nme:NMB2052 (best score: 856.284)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
HMP: SRS015062.8306-T1-C
LinkDB
Position
C169553:510..1859
AA seq 449 aa
MANQTNSKAKALLGWMDARFPLSKMWNEHLAQYYAPKNFNFWYYFGSLALLVLVIQIVSG
IFLTMNYKPDGNLNAYHLPAAFTAVEYIMRDVSGGWIIRYMHSTGASFFFIVVYLHMFRG
LIYGSYKKPRELVWIFGSLIFLALMAEAFMGYLLPWGQMSFWGAQVIINLFSAIPVIGPD
LSTWIRGDFNVSDVTLNRFFALHVIAVPLVLLGLVVAHIIALHEVGSNNPDGVEIKKNKD
ENGIPRDGIPFHPYYTVKDILGVVVFLIVFCAVLFFAPEGGGYFLEAPNFDAANALKTPP
HIAPVWYFTPFYAILRAIPSFLGTQVWGVIGMGAAVVLIALLPWLDRGEVKSVRYRGPIF
KTALVLFIISFIGLGILGAMVATDTRTLVARILSFVYFAFFLGMPFYTKLDKNKPVPERV
TMSTAKQKIMFFVYVGITAVGAYLFATNI

DBGET integrated database retrieval system