KEGG   T30241 (Metagenome): 8307
Entry
8307              CDS       T30241                                 

Gene name
petC
Definition
cytochrome C1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Best hit
nme:NMB2051 (best score: 531.946)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
02020  Two-component system
04260  Cardiac muscle contraction
04714  Thermogenesis
04932  Non-alcoholic fatty liver disease
05010  Alzheimer disease
05012  Parkinson disease
05014  Amyotrophic lateral sclerosis
05016  Huntington disease
Other DBs
HMP: SRS015062.8307-T1-C
LinkDB
Position
C169553:1859..2662
AA seq 267 aa
MRAVKMKQAMKNWFAALLLAVPMGAAFASGGHAHYEKVDIDLRDQVSLQRGAQIFTNYCL
SCHSASGMRFNRLKDIGLTDEEIKKNLMFTTDNVGDVMHSAMNPKDAAKWFGAAPPDLTL
IARSKGADYLYAYMRGFYKDPTRPSGWNNTVFDKVGMPHPLWEQQGVQAVELDAKGQPVM
VKDEHGEMKPKLYWESTGLHSRRLPNGKVIQKEYDAYVRDLVNYLVYMGEPAQLQRKRIG
YVVMIFLFAVMLPLAYFLKKEYWKDVH

DBGET integrated database retrieval system