KEGG   T30241 (Metagenome): 8354
Entry
8354              CDS       T30241                                 

Definition
lactate/malate dehydrogenase, NAD binding domain protein
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Best hit
pru:PRU_2158 (best score: 549.666)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8354-T1-C
LinkDB
Position
C169577:complement(2351..3343)
AA seq 330 aa
MSFLTNEKLVIVGAGGMIGSNMAQSVLTLGLTPNVCLYDIFEPGLHGVADEIAHCGFPGA
NVTWTTDPKEAFIGAKYIISSGGAPRKEGMTREDLLKGNCQIAAEFGDHIKQYCPDVKHV
VVIFNPADVTALTALIHSGLKPNQLTSLAALDSTRLQQALALEFGVQQDKVTGAHTYGGH
GEQMAVFASKVKIDGKPLSEMNLSDERWAAIKHDTIQGGSRIIKLRGRSSFQSPAHNAVK
MIEAAMGGEKFTLPAGCYVNDERLGFKNVMMAMPTTIDSTGVHYELPTGTDEEMAALKAS
YEHLCKMREEIVGLGIIPAVSDWKNDNANL

DBGET integrated database retrieval system