KEGG   T30241 (Metagenome): 8865
Entry
8865              CDS       T30241                                 

Gene name
sucD
Definition
succinate-coA ligase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Best hit
nme:NMB0960 (best score: 561.222)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00640  Propanoate metabolism
00660  C5-Branched dibasic acid metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8865-T1-C
LinkDB
Position
C169905:complement(159..1049)
AA seq 296 aa
MSVLINKDTKVLVQGFTGKNGTFHSEQALAYGTKVVGGVTPGKGGQTHLNLPVFNTMKEA
VKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETNGNGTR
LVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQSTCIGI
GGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSNVSKPVVGYIAGVT
APKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLKAKGLA

KEGG   T30241 (Metagenome): 7693
Entry
7693              CDS       T30241                                 

Gene name
sucD
Definition
succinate-coA ligase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Best hit
pmz:HMPREF0659_A5760 (best score: 457.603)
Taxonomy
Bacteroidetes [GN:pmz]
Pathway
00020  Citrate cycle (TCA cycle)
00640  Propanoate metabolism
00660  C5-Branched dibasic acid metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7693-T1-C
LinkDB
Position
C169097:1330..2202
AA seq 290 aa
MSILINKDTRLIVQGITGRDGSFHATKMKEYGTNVVGGTSPGKAGQEVAGIPVFNTVRDA
VEATNANTSVIFVPAAFAKDAMLEAADAGIKLIICITEGVPTLDVVEAYRYIQIKGAQLI
GPNCPGLISPGESMVGIMPTNIFKKGHTGVISRSGTLTYQVVASLTAEGMGQSSAIGVGG
DPIVGLYFQELLEMFQNDPETDSIAIIGEIGGDAEERAAEYIKKYVTKPVVAFISGREAP
KGKQMGHAGAIISSGSGTAAEKVAAFEAAGIPVARETHEIPTLLKQKLGK

KEGG   T30241 (Metagenome): 7692
Entry
7692              CDS       T30241                                 

Gene name
sucC
Definition
succinate-coA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Best hit
pmz:HMPREF0659_A5761 (best score: 579.711)
Taxonomy
Bacteroidetes [GN:pmz]
Pathway
00020  Citrate cycle (TCA cycle)
00640  Propanoate metabolism
00660  C5-Branched dibasic acid metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7692-T1-C
LinkDB
Position
C169097:167..1300
AA seq 377 aa
MKVHEYQAKEFFASYGIPVQRGIVCRTPEEAVKAYETLGVELAVVKAQVHTGGRGKAGGV
KLGKTAEEVRTHATNILGMDIKGFIVDRVLVCAALDIKSEFYVSILPDRKSKSAIFMVSR
EGGMDIEAVAKETPEKIAKIAIDPAVGLNDYKAREIAFKLFDDKKYVNQAVPLFKNLYRL
FIEKDASLTEINPLVITEQDELSAVDAKMTFDNNALFRHPDVLELFEPTEDEKKEQEAKD
KGFSYVNLGGEIGCMVNGAGLAMATMDMIKLYGGNPANFLDIGGSSNPTKIVEAMKLLLS
DKHVKVVLINIFGGITRCDDVAQGLIEAFKLIDTDMPIVIRLTGTNEAEGRELLKGTKFH
VATTMSEAGHMAVDLCK

KEGG   T30241 (Metagenome): 8866
Entry
8866              CDS       T30241                                 

Gene name
sucC
Definition
succinyl-coA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Best hit
nme:NMB0959 (best score: 717.998)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00020  Citrate cycle (TCA cycle)
00640  Propanoate metabolism
00660  C5-Branched dibasic acid metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8866-T1-C
LinkDB
Position
C169905:complement(1060..2226)
AA seq 388 aa
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RITFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVQGVLINIFGGIVRCDMIAEAIVAAVKEINVNVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA

DBGET integrated database retrieval system