KEGG   T30241 (Metagenome): 8871
Entry
8871              CDS       T30241                                 

Gene name
glk
Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
nme:NMB1390 (best score: 593.578)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8871-T1-C
LinkDB
Position
C169909:3..908
AA seq 301 aa
ETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSGATAVRHAAFAIANPILGDWVQMTNHHW
AFSIETTRQTLGLDTLILLNDFTAQALAVTQTSSKDLMQVGGQKPVEFAPKAVIGPGTGL
GVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVLIWQYAKNKYGHVSAERFLSGAGLSLVY
EALAAKQKAKPAKLMPSEITEKALSGTSPLCRQTLDIFCAMLGTVASNLALTLGARGGVY
LCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLAAIPVYVVLSEFPGISGAAAALDNHLRN
V

KEGG   T30241 (Metagenome): 5628
Entry
5628              CDS       T30241                                 

Definition
ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
pru:PRU_0241 (best score: 312.383)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5628-T1-C
LinkDB
Position
C166910:553..1182
AA seq 210 aa
MIEEQELKSFVIGLDLGGTNSVFGIVDQRGQVLATTSIKTQSYKTVEDFVDAGIEVLKPI
IAKVGGISQIKAMGIGAPNGNFYRGTIENAANLVWAHDSVVPLADMFSKRLNIPVGLTND
ANAAAIGEMQYGVARGMKDFIMITLGTGVGSGIVVNGQMVYGSDGFAGELGHVIMVRGEE
GRSCGCGRKGCLEAYCSATGVARTAREFLQ

KEGG   T30241 (Metagenome): 2344
Entry
2344              CDS       T30241                                 

Definition
ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
erb:A4V01_10040 ciu:G4D55_08815 (best score: 137.117)
Taxonomy
Firmicutes - Others [GN:erb]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.2344-T1-C
LinkDB
Position
C161366:complement(1..393)
AA seq 131 aa
SHGFGGEIANIIIDRSREKINYLNVGAIENEASGTAIVRKGRALFPQEDIQHAGQIFQLA
DQGNKKAIQLKKEIIQDLGQLLATLSCAVDPEAFVLGGGVMKSADSFFTEVIQSFQAQSH
TMVGDTQFLMA

KEGG   T30241 (Metagenome): 3898
Entry
3898              CDS       T30241                                 

Definition
ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
pru:PRU_0241 (best score: 164.081)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.3898-T1-C
LinkDB
Position
C164288:complement(270..638)
AA seq 122 aa
AREFLQKTKDPSLLRDINPEEITSLDVSIAAGKGDKMALDIFAFTGDMLGAACADFANFS
SPEAFVFFGGLTKAGDLLMNPIKAAYAKYVLPTYRDNVKFLVSSLDDAAAAVLGASAIGW
EI

KEGG   T30241 (Metagenome): 5874
Entry
5874              CDS       T30241                                 

Definition
glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
fnu:FN1164 (best score: 567)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5874-T1-C
LinkDB
Position
C167220:complement(38..985)
AA seq 315 aa
MKHYIGIDLGGTNTKIGVVDSEGNLINSKIIKTHSHQNVDKTLERIWETAKKLILEKEIP
LFSVVGIGIGIPGPVKNQSTVGFFANFDWERNLNLKEKMEKLSGIETRIENDANIIAQGE
AIFGAAKGKKSSITIAIGTGIGGGIFYNGNLISGMSGVGGEIGHMKVVKDGKTCGCGQNG
CFEAYASASSLVKEAQERLKLNEENLLFKEINGNLAELEAKNIFDAARKGDEFSKDLIEY
ESDYLALGIGNLLNIINPECIVISGGISLAGDEILLPIKEKLKKYTMPPALENLEIKVGV
LGNEAGIKGAVALFI

DBGET integrated database retrieval system