KEGG   T30241 (Metagenome): 8919
Entry
8919              CDS       T30241                                 

Definition
2-oxoglutarate oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_1149 (best score: 238.424)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.8919-T1-C
LinkDB
Position
C169931:complement(1..405)
AA seq 135 aa
MAEQEVTLMKGNEAIAHAAIRCGADGYFGYPITPQSEIIETFALLKPWETTGMVVLQAES
ETSSINMIYGGAGAGKRVLTSSSSPGIALMQEGISYMAGAELPGVFVNVQRGGPGLGTIQ
PSQSDYFQATRGGGN

KEGG   T30241 (Metagenome): 6080
Entry
6080              CDS       T30241                                 

Definition
2-oxoacid:acceptor oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2267 (best score: 254.988)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6080-T1-C
LinkDB
Position
C167468:complement(3..455)
AA seq 151 aa
MEEQIEVKELEHVVVLFSGDSGDGMQLAGNIFSNVSATVGNGISTFPDYPADIRAPQGSL
TGVSGFRVHIGAGKVYTPGDKCDVLVAMNAAALKTQYKNCKPQGTVIIDTDSFSSRDLKK
ADFTTDDYLKEMGIDPDRVVACPITKMVKDC

KEGG   T30241 (Metagenome): 1424
Entry
1424              CDS       T30241                                 

Definition
pyruvate synthase
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2267 (best score: 113.62)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.1424-T1-C
LinkDB
Position
C159411:94..315
AA seq 74 aa
MKGLEVKELKQVVIRFSGDSGDGMQLAGTIFSLVSATAGNSISTLQDYPADIRAPQGSLT
GVSGYQVKIGDEEV

KEGG   T30241 (Metagenome): 5942
Entry
5942              CDS       T30241                                 

Definition
2-oxoglutarate oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_1149 (best score: 364.385)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5942-T1-C
LinkDB
Position
C167298:complement(612..1316)
AA seq 234 aa
QATRGGGNGDYNVIVLAPNSVQEMADFVDLAFELAFKYRNPAMILSDGVIGQMMEKVVLP
PIKPRRTEEEIEKECPWASMGRKVGREPNVITSLELKSEVMEKRNLHLQEKYKTIRETET
RFETSLCEDADYIIVSFGSASRIGEKAVELAREQGLKVGLFRPITLWPFPSKELVEISKG
KKGILVSEINAGQMVQDVRLAIDGALPVEHFGRLGGIVPDPEEIVEALKDKLIK

KEGG   T30241 (Metagenome): 7844
Entry
7844              CDS       T30241                                 

Definition
2-oxoacid:acceptor oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2267 (best score: 687.567)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7844-T1-C
LinkDB
Position
C169201:1..1443
AA seq 480 aa
ADTGMDNKAMLKCRNMFALGLVCWLFNRDLELVNNFLTEKFKKKPAVAEANIKVVAAGYD
YGHNVHASVPNTYRIETKEKVAGRYMDITGNKATAYGLMAAAEKAGLTLFLGSYPITPAT
DILHELAKHKSMGVVTVQCEDEISGAASAIGAAFAGALAATSTSGPGICLKSEALNLAVI
DELPLVVIDVQRGGPSTGLPTKSEQTDLLQVLYGRNGESPMPVIAATSPTDCFDAAFAAC
KMALEHMTPVVLLTDAFIANGSSAWKLPNLEDLPEIRPHYATEAQRYKYTPYKRDEYSNV
RYWAVPGMEGYEHILGGLEKDGKTGAISTDAENHHLMDNLRFDKVARIPVPDLEVQGDKD
DADLLIVGFGSTYGHLYSAMQELRAKGHKIALAQFKYVNPLPKNTAEVLSRYNKVVVAEQ
NLGQLAALLRIRINNFAPYQYNQVKGQPFVVQELVQGFERLLTLPAPKDEYGTFYSRILQ

KEGG   T30241 (Metagenome): 1943
Entry
1943              CDS       T30241                                 

Definition
2-oxoglutarate oxidoreductase, alpha subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_1149 (best score: 163.696)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.1943-T1-C
LinkDB
Position
C160544:complement(1..357)
AA seq 119 aa
PRRTEAEILRECPWASTGRTKDRTPNIITSLELMPEVMEQKNLHLQEKYQQIKDNETRCE
QSKCDDADYIVVAFGSAARIAEKSMEIAREHDIKLGLFRPITLWPFPEKELRKTAAGKK

KEGG   T30241 (Metagenome): 7845
Entry
7845              CDS       T30241                                 

Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
pru:PRU_2268 (best score: 562.762)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.7845-T1-C
LinkDB
Position
C169201:1461..2468
AA seq 335 aa
MTQYTDKDYKKGQPRWCPGCGDHFFLASLHKAMAELGVPPYETAVISGIGCSSRLPYYVS
TYAMQTIHGRAAAIATGLKVANPKLTVWQVSGDGDGLAIGGNHFIHAMRRNIDINIILLN
NRIYGLTKGQYSPTSPRGFVSKSSPYGTVEDPFRPAELCFGARGKFFARTVATDAPGTIE
VLKAAKQHKGAAVCEILQNCVIFNEGCHDAVYNKEGRKANAIYLEHGKPLIFGVDNEFGL
VQEGFGLKVVKIGEDGYTIDDILVHDAHCEDDTLQLKLAMMDTQEGFPVALGIIRDVEAP
TYDAAVWEQIEEVKAKKPYHNFAELLETNDIWEVK

KEGG   T30241 (Metagenome): 6457
Entry
6457              CDS       T30241                                 

Definition
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
bacc:BRDCF_p994 (best score: 97.8265)
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.6457-T1-C
LinkDB
Position
C167916:1..198
AA seq 65 aa
SINKAKKAIRKAFEASMLGKGSSLVEIVATCNSGWKLTPAQANEWMRENMFPHYQKGDLK
DETGI

KEGG   T30241 (Metagenome): 5941
Entry
5941              CDS       T30241                                 

Definition
thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Best hit
bth:BT_0330 (best score: 323.553)
Taxonomy
Bacteroidetes [GN:bth]
Pathway
00010  Glycolysis / Gluconeogenesis
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS015062.5941-T1-C
LinkDB
Position
C167298:complement(1..591)
AA seq 197 aa
MAANNIISPENLVYAKPKLMNDTTMHYCPGCSHGVVHKLVAEVIADMGMEEKTIGVSPVG
CAVFAYRYIDIDWQEAAHGRAPAVATGIKRLWPDRLVFTYQGDGDLACIGTAETIHALNR
GENITIIFINNAIYGMTGGQMAPTTLIGQKTATCPFGRTPDIHGYPLNMTDLASRLEGTC
YVTRQSVDTVASINKAK

DBGET integrated database retrieval system