KEGG   T30241 (Metagenome): 923
Entry
923               CDS       T30241                                 

Definition
putative pantothenate kinase
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Best hit
pru:PRU_0313 (best score: 340.502)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS015062.923-T1-C
LinkDB
Position
SRS015062_WUGC_scaffold_641:complement(1764..2597)
AA seq 277 aa
MKIAIGIDVGISTTKIVGIRNGEVVRPLRIKATDPLTSLYGAFGKYLYDNKIELSDVGKV
MLTGVGSAYIDKPVYGLPTEKADEFLADGLGARFEANLNRMIVVSMGTGTSLVLCDGDDI
RHIGGIGIGGGTLNGLSRLLLNTDDIHQISDLAKKGDIGNINLQISDISAKPLPGLPMNA
TASLFANARGNARSEDVALGLICLVLQSIGSSAILSALNSGIKDFVMIGNLSRLPQCKIL
FPMMERLYDVHFIIPKYSEYCTAIGCALQASNELKLG

DBGET integrated database retrieval system