KEGG   T30241 (Metagenome): 9491
Entry
9491              CDS       T30241                                 

Gene name
ribE
Definition
riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Best hit
nme:NMB1247 (best score: 407.142)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.9491-T1-C
LinkDB
Position
C170187:3662..4366
AA seq 234 aa
MLSEGISDGIFRGEMLQFAPFLPTQGNRIMFTGIVQGLGKLTAIHRPSEAFQTYVVELPQ
EAADNLQRGASVANNGCCLTITEIEGNRVSFDLMAETLAKTNLGLLKEGDCVNIERAARF
GDEIGGHVMSGHIMATVPIVEIERDGYNRTVWFSLPHELKPYILTKGFVGLDGCSLTIGK
VEDSRFNVHLIPETLERTLFGSRKVGDRINIEIDPNTQAIVDTVERLMAQRYAK

KEGG   T30241 (Metagenome): 5967
Entry
5967              CDS       T30241                                 

Gene name
ribE
Definition
riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Best hit
pru:PRU_1369 (best score: 328.946)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.5967-T1-C
LinkDB
Position
C167328:521..1126
AA seq 201 aa
MFSGIVEEMAQVVAIERYQENIDFVLKCSFTSELKIDQSIAHNGVCLTVVRLQGETYTVT
AMKETLDRSNLGLLKVGDRVNVERSMLMNGRLDGHIVQGHVDETARCVAMENANGSTYFT
FEYKDDVEMAQRGYFTVDKGSVTVNGVSLTVCEPTANTFKVAIIPYTLENTNFADIQVGS
VVNLEFDILGKYIARLNSLSK

KEGG   T30241 (Metagenome): 6673
Entry
6673              CDS       T30241                                 

Gene name
ribE
Definition
riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Best hit
fnu:FN1507 (best score: 415.231)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00740  Riboflavin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS015062.6673-T1-C
LinkDB
Position
C168134:132..788
AA seq 218 aa
MFTGLVEEKGSVVSLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSKDYFVA
DCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEGIAKIY
EIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVGDIVNI
ETDLVGKYIERFVYFDKLEEKENKKNKITREFLLENGF

DBGET integrated database retrieval system