KEGG   T30245 (Metagenome): 11194Help
Entry
11194             CDS       T30245                                 

Gene name
hisB
Definition
histidine biosynthesis bifunctional protein hisB
  KO
K01089  imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15]
Best hit
aap:NT05HA_1774 (best score: 176.022)
Taxonomy
Gammaproteobacteria - Others [GN:aap]Taxonomy
Pathway
00340  Histidine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.11194-T1-C
LinkDB All DBs
Position
C715172:2..265
AA seq 87 aa AA seqDB search
CALDLSGRPWIKFNAKFKRDKVGDFSTELTEHFFQSLAFSLLATLHLKATGDNDHHKIES
LFKVFGRTLRQAIRIEGNELPSSKGVL

KEGG   T30245 (Metagenome): 20988Help
Entry
20988             CDS       T30245                                 

Definition
histidinol phosphate phosphatase hisJ family protein
  KO
K04486  histidinol-phosphatase (PHP family) [EC:3.1.3.15]
Best hit
fnu:FN0428 (best score: 291.197)
Taxonomy
Fusobacteria [GN:fnu]Taxonomy
Pathway
00340  Histidine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.20988-T1-C
LinkDB All DBs
Position
C737612:3..518
AA seq 172 aa AA seqDB search
IGYTPNSEKRIEDFLKNKNFNLKLLSIHQNGLYDYMCVNKKLISLEALIQEYFEQMIQAL
ESSIEFNVLAHFEYGIRIVDISVTDFDSLASKFLNKIIELIVKKEIAFEVNTKSMYKYKK
ESLYSYMIEKYLKKGGKLFTLGSDAHNIKDYAYKFDEARKFLLTRNIKEIIL

KEGG   T30245 (Metagenome): 8377Help
Entry
8377              CDS       T30245                                 

Definition
histidinol-phosphate phosphatase
  KO
K05602  histidinol-phosphatase [EC:3.1.3.15]
Best hit
rmu:RMDY18_07040 (best score: 531.946)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00340  Histidine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.8377-T1-C
LinkDB All DBs
Position
SRS015154_WUGC_scaffold_7660:complement(46..987)
AA seq 313 aa AA seqDB search
MSRPQQYTDDLRLAHILADSVDRVSAMRFRDRPVFSPASEVVEPAEAAPAAAPLAPWQQA
TQQPVEPQAPVQEPADYASGVAQEVEELLRAQLSRVRTRDGIAGAHAGYNGQAARQWVIA
PIAELDNFRRGVPVWATLIALLDQGEPVVGVVSAPALGRRWWAARGSGAYTGKSLAQATR
LEVSSLTQLVQLSAAYTDLSSWKAASEGAVDRSGELVQLLGCVGRSRAYGSFWAACMLAE
GAVDTVVDASLSFYEVAALLPLIREAGGVVSTLEGDLPEHAGVSAAGVRPVSLVASNTAA
VQQQVLEALAPQS

DBGET integrated database retrieval system