KEGG   T30245 (Metagenome): 12243Help
Entry
12243             CDS       T30245                                 

Definition
ribulose bisphosphate carboxylase large chain, catalytic domain
protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Best hit
vpr:Vpar_1263 (best score: 209.149)
Taxonomy
Firmicutes - Others [GN:vpr]Taxonomy
Pathway
00630  Glyoxylate and dicarboxylate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS015154.12243-T1-C
LinkDB All DBs
Position
C717610:2..319
AA seq 106 aa AA seqDB search
GRLESLEPIVEDSPYINVGVMPNAVIDTSRYYLARISYHVDTTALEATQFLNVVFGNSSL
QPHIWVVDIELCPTLYDVFKGPRFGLQGIRRLVETPTRPMIQAVVK

DBGET integrated database retrieval system