KEGG   T30245 (Metagenome): 2157Help
Entry
2157              CDS       T30245                                 

Gene name
metC
Definition
cystathionine beta-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
hin:HI0122 (best score: 318.161)
Taxonomy
Gammaproteobacteria - Others [GN:hin]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.2157-T1-C
LinkDB All DBs
Position
SRS015154_WUGC_scaffold_2932:complement(361..912)
AA seq 183 aa AA seqDB search
VGHSDIMIGTAVANARAWDKLREHSYLMGQMVDADSAYTTARGIRTLGVRLKQHHESSLK
VAKWLSEQPEVKAVYHPALPSCPGHENFKRDFTGASGLFSFELHKRLNDEELSAFMDNFE
LFTMAYSWGGFESLILCNQPEDIAKIRPGIERKLTGSLIRLHIGFEDTDELIADLQAGFD
RIK

KEGG   T30245 (Metagenome): 28698Help
Entry
28698             CDS       T30245                                 

Definition
cystathionine beta-lyase/cystathionine gamma-synthase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
rmu:RMDY18_18590 (best score: 537.724)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.28698-T1-C
LinkDB All DBs
Position
C752360:complement(763..1614)
AA seq 283 aa AA seqDB search
GGTYRFATTELTKRAVKTRFISDFTTLSDEDFTPDVKVVFLETPTNPTLQVTDIAAVAEL
VHRHGALLIVDNTFMTPYLQRPLELGADITVQSATKFLAGHADLLAGVAATNDPDLAILL
HRGQLVSGALLPPIDSYRLLQDVKTLALRLERQQQNARELIEFLSERPEVEKIFYAGSSS
EEQTEVQSRQARGIGSVFSLLLKDGGDAQAFARSLPIFVNAVSLGGIESLVSLPAHTTHG
AYAQEHRDEFGVDDRLVRLAIGIEDIQDLIAALEIGLKAAFSG

KEGG   T30245 (Metagenome): 18107Help
Entry
18107             CDS       T30245                                 

Definition
cystathionine beta-lyase, PLP-dependent
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
aap:NT05HA_1016 (best score: 248.825)
Taxonomy
Gammaproteobacteria - Others [GN:aap]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.18107-T1-C
LinkDB All DBs
Position
C731228:3..422
AA seq 140 aa AA seqDB search
CYLYPCGAAAVTNAILSFVETGDHVLMTGAAYEPTQDFCNVILKKMHIDTTYYDPMMGTD
IAKLVQPNTKVLFLESPSSLTMEVPDIPAIVKAVRAVSPEIVIMIDNTWAGGVLFKALEH
GIDISIQAGTKYLVGHSDIM

KEGG   T30245 (Metagenome): 26164Help
Entry
26164             CDS       T30245                                 

Definition
hypothetical protein
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
got:AXE85_06740 (best score: 278.87)
Taxonomy
Firmicutes - Bacilli [GN:got]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.26164-T1-C
LinkDB All DBs
Position
C748193:1..534
AA seq 177 aa AA seqDB search
DVTAGCAVTNNEDIASEICLLQKNFGGILGVEDAWLILRGMKTMGLRMEKSVENARILTK
FLETQDKIKKVYYPNLTSCKFYDIHTEQASSGGAVFSFEFFEQDDLKTFLKKIKIPIYAI
SLGGVESIISHPATMSHACMSEEERLAQGVTQTLLRFSCGVEDSEDLIEDLKQALNN

KEGG   T30245 (Metagenome): 27686Help
Entry
27686             CDS       T30245                                 

Definition
aluminum resistance protein
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
got:AXE85_06740 (best score: 312.768)
Taxonomy
Firmicutes - Bacilli [GN:got]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.27686-T1-C
LinkDB All DBs
Position
C750792:626..1258
AA seq 211 aa AA seqDB search
MKGVNTNLLHGYPVIDDYTGAASIPKYQVTTFDQKEGYKDCGKYSYSRFGNPTILALEAA
VANLHKAKFGFAFASGMSAITTVLMLLNCGEHIVLPKDVYGGTFQFSSKILKKYGIEVSF
INYQNLEELEATIKDNTAMIYIETPSNPLLKVSDIKAIVEIAKKHNIKTVADNTFMTALY
QKPLDLGCDIVIESLTKFVNGHSDVTAGCAV

KEGG   T30245 (Metagenome): 19187Help
Entry
19187             CDS       T30245                                 

Definition
cystathionine beta-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
nmp:NMBB_0907 nme:NMB0802 (best score: 276.944)
Taxonomy
Betaproteobacteria [GN:nmp]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.19187-T1-C
LinkDB All DBs
Position
C733584:complement(2..451)
AA seq 150 aa AA seqDB search
AFSSGMAGIDAVWRTFLRPGDTIVAVADIYGGAYDLLVDVYKEWGVNVVFADLGNPDRLD
ELLAAHNVKLVWLETPSNPLLRLVDIKALAAKAHAVGALVGIDNTFATPYLQQPLEMGCD
IVFHSATKYLCGHSDVLMGIVAVKTKELAK

KEGG   T30245 (Metagenome): 28395Help
Entry
28395             CDS       T30245                                 

Definition
cystathionine beta-lyase/cystathionine gamma-synthase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
rmu:RMDY18_18610 (best score: 535.798)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.28395-T1-C
LinkDB All DBs
Position
C751890:1..858
AA seq 285 aa AA seqDB search
GGTYRFATIELPARGVKTRFIGDFTALTDEDFTDNVTMVFLESPSNPLLRVSDIAAIAEI
AHRNGAIVVVDNTFMTPLLQKPLDLGADISVQSATKYLGGHADLLGGVAATNDDALAERL
WHLQMITGAMLSPTDSYRLLQEVKTLKLRLTQQQKNTIEVINYLEAHPAVKRVLYAGSHS
EYEAQVHARQANGLGALISMELVDGADLPAFLEALKIFSHAVSLGGIESLVVRPALMVQA
AYTQAHRDEYGVSDNLIRLAIGIEEIEDIIEDLERGLTAALAHQA

KEGG   T30245 (Metagenome): 30730Help
Entry
30730             CDS       T30245                                 

Definition
cystathionine beta-lyase/cystathionine gamma-synthase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
rmu:RMDY18_18610 (best score: 219.164)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.30730-T1-C
LinkDB All DBs
Position
C754904:complement(2..319)
AA seq 106 aa AA seqDB search
MTGFTTKAIHTTDRDNPYGSILPPIYTTTTYAQPCDGTEGPYDYQRGGNPTRAALETTLA
TLEGAKHAFAYPSGMGATAAALGILKEGETLLLGMPSYGGTYRFAT

KEGG   T30245 (Metagenome): 29420Help
Entry
29420             CDS       T30245                                 

Definition
aspartate aminotransferase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
got:AXE85_04730 (best score: 553.132)
Taxonomy
Firmicutes - Bacilli [GN:got]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.29420-T1-C
LinkDB All DBs
Position
C753374:complement(2..1138)
AA seq 379 aa AA seqDB search
MTRVEEFVKKYYVERRNTNSLKWDALEERFGDPELLALWVADMEFKTPESIREALSERVA
HGVFGYTKLPESYYYEYKNWHKEKYDFEVDKQWIRFAPGIVQAILWVIKAYTRKEDAIII
MPPVYYPFANSIRNSGRKLVKSPLLEEDGKFKIDFETFEKEIRENDVKLYIHCSPHNPVG
RVWTFEEQKRVFEICEKHDVLVLSDEIHQDFTYGNHKQISALALEGGRYNNRLIVANSGS
KTFNLASLVHATLLIPDSNVREQFDKFSKENLGAEPSLLGQIALEAGYRDGKDWVEGLKA
TILHNYNLIHDTLAQKVPEIKVYPLEGTYLVFLNLENVLNGKSTKQFIQDECGLAIDFGH
WFGKGYNSYVRINLATSPE

KEGG   T30245 (Metagenome): 14995Help
Entry
14995             CDS       T30245                                 

Definition
aspartate aminotransferase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
got:AXE85_04730 (best score: 119.783)
Taxonomy
Firmicutes - Bacilli [GN:got]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.14995-T1-C
LinkDB All DBs
Position
C724030:complement(3..233)
AA seq 77 aa AA seqDB search
MSRVEEFVNKYYVERRNTNSLKWDALEERFGDKDLLAMWVADMEFKTPESIREALIERIN
HGVFGYTKLPESYYDQY

KEGG   T30245 (Metagenome): 7646Help
Entry
7646              CDS       T30245                                 

Definition
aspartate aminotransferase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
got:AXE85_04730 (best score: 481.1)
Taxonomy
Firmicutes - Bacilli [GN:got]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.7646-T1-C
LinkDB All DBs
Position
SRS015154_WUGC_scaffold_7281:complement(476..1450)
AA seq 324 aa AA seqDB search
ESYYDQYKKWHKQKYDINVEKQWIRFAPGIVQAILWVIHAYTKKDDSVIIMPPVYYPFAN
SIRNSGRKLVESPLLEENGKFKIDFDTFEKEIRDNNVKLYIHCSPHNPVGRVWMLEEQKR
VFEICEKYDVLVLSDEIHQDFTYNNHKQISALALEDGKYNHRLIVANSGSKTFNLASLVH
ATLLIPDDTVRKVFDAYKKENLEAEPSLLGQIALEAGYREGHEWLEGLKETVLYNYNLLH
DTLAEKVPEIKVYPLEGTYLVLVNLEKVLDGKTTKQFIQDECGLAIDFGHWFGKGYNKYI
RINLATSPENVKEAINRIIKNCNN

KEGG   T30245 (Metagenome): 12827Help
Entry
12827             CDS       T30245                                 

Definition
aspartate aminotransferase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
fnu:FN0625 (best score: 193.356)
Taxonomy
Fusobacteria [GN:fnu]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.12827-T1-C
LinkDB All DBs
Position
C718992:2..325
AA seq 108 aa AA seqDB search
KGTYSLKWDALDKRFGNADLISMWVADMEIKAPKEVIEALKERCEHGVFGYSYVSDEYYN
SVINWLKEKHNYEIKKEWLRFTNGVVTAIYCFVNIFTKVDDAVLILTP

KEGG   T30245 (Metagenome): 17889Help
Entry
17889             CDS       T30245                                 

Definition
hemolysin
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
spn:SP_1524 (best score: 229.565)
Taxonomy
Firmicutes - Bacilli [GN:spn]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.17889-T1-C
LinkDB All DBs
Position
C730746:complement(2..418)
AA seq 139 aa AA seqDB search
AVRQAIRDYADQLVYGYTYPSEELYRAVQEWEKSEHGYVFEKEAIVFMEGVVPSISTAIQ
AFTKEGEAVLINTPVYPPFARSVRLNQRKLVTNSLVEVDGLFQIDFEQLEKDFVEHQVKL
YILCNPHNPGGRVWEREVL

KEGG   T30245 (Metagenome): 22457Help
Entry
22457             CDS       T30245                                 

Gene name
lcd
Definition
betaC-S lyase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
spn:SP_1524 (best score: 74.3294)
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.22457-T1-C
LinkDB All DBs
Position
C740814:complement(3..140)
AA seq 46 aa AA seqDB search
MGKEQFLTVPNRLGHHTSKWKESEQDPELLPAWIADMDFESLPAVR

KEGG   T30245 (Metagenome): 8435Help
Entry
8435              CDS       T30245                                 

Gene name
malY
Definition
possible cystathionine beta-lyase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
spn:SP_1524 (best score: 151.369)
Taxonomy
Firmicutes - Bacilli [GN:spn]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.8435-T1-C
LinkDB All DBs
Position
SRS015154_WUGC_scaffold_7682:1..366
AA seq 121 aa AA seqDB search
ISALGFIATEVAYQNGKAWLEDLKEVLEENINYTVEVLREQTDIGMMKPQGTYLLWLDFS
AYGLSEEELHARLHDQAKVILNKGTDFGVEGKQHARLNVAAPKTLVQEIVDRIVTNFPKK
G

KEGG   T30245 (Metagenome): 16853Help
Entry
16853             CDS       T30245                                 

Definition
aspartate aminotransferase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Best hit
fnu:FN0625 (best score: 257.299)
Taxonomy
Fusobacteria [GN:fnu]Taxonomy
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS015154.16853-T1-C
LinkDB All DBs
Position
C728344:complement(1..393)
AA seq 131 aa AA seqDB search
LILTPVYYPFHNAVKDNNRKLITCDLKNTDGYFTIDYEEVEKKIVENNVKLFIQCSPHNP
AGRVWKEEELAKILEICKKHNVLVISDEIHQDIIMKGYKHIPSAIVANGKYADNLITISA
ASKTFNLAGLI

DBGET integrated database retrieval system