KEGG   T30302 (Metagenome): 10007
Entry
10007             CDS       T30302                                 

Definition
nitrite reductase [NAD(P)H], large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Best hit
rmu:RMDY18_08870 (best score: 229.18)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.10007-T1-C
LinkDB
Position
C464174:complement(2..352)
AA seq 117 aa
VKDASSEEVVRYIDRYLMYYIRTADKLQRTARWLEDLDEEHGDGLAHLQSVLIEDSLGVC
EDLERDMQRHVDSYQDEWAATLKDERRLRRFRAFINEPDGSDEAAHLFVLEREQIRP

KEGG   T30302 (Metagenome): 11354
Entry
11354             CDS       T30302                                 

Definition
nitrite reductase [NAD(P)H], large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Best hit
rmu:RMDY18_08870 (best score: 249.595)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.11354-T1-C
LinkDB
Position
C467250:complement(2..385)
AA seq 128 aa
DAILCSCNNISFGEVRQAVVDGNHDVPALKACTTAGTQCGSCVPMLQKTLEQQMKKMGMT
VSKALCEHFDFSRAELAEAVRLTNLDDFDSVIARFGHGGDGCAICKPTVASILSSFRNSY
VLDAGRGG

KEGG   T30302 (Metagenome): 14508
Entry
14508             CDS       T30302                                 

Definition
nitrite reductase [NAD(P)H], large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Best hit
rmu:RMDY18_08870 (best score: 268.47)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.14508-T1-C
LinkDB
Position
C474229:complement(3..494)
AA seq 164 aa
VEVDQGGGYAVNAQIKATGIDIETGAFISAINKDASGEVISVSVADSTSDEAVIHQIDAD
LVVFAAGIRPNDELARAAGLETGERGGILVNNACHTSDEHIWAIGEVACVLGRTWGLVAP
ANAMADAVAKNLLNGNEDAQVEEFDIATKLKFSGVQVAGFGDRR

KEGG   T30302 (Metagenome): 14734
Entry
14734             CDS       T30302                                 

Definition
nitrite reductase [NAD(P)H], large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Best hit
raj:RA11412_2027 (best score: 308.531)
Taxonomy
Actinobacteria [GN:raj]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.14734-T1-C
LinkDB
Position
C474673:complement(2..505)
AA seq 168 aa
QNGPGNTARNILVVGAGPAAWRFVRAYHEGAQDAGRASDTITVLNDEPYIPYDRVAIEQL
FKDTDKDLTLGDPTLWDESTIKLVNNTRGESLNRDSCVVKGSDGVDYPYDVLVFATGSSA
VRIPIPNADCAHVFRTADDVKNMVSEVERLQTKLGRAPRGIVVGGGLL

DBGET integrated database retrieval system