KEGG   T30302 (Metagenome): 1008
Entry
1008              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L73818 (best score: 188.348)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1008-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1099:3..440
AA seq 145 aa
QYTEDFNTPEAISHILNRESGLLGVSGQSSDMRDVIAAKKEGDHDATLAYEIYIDRIQKH
IGQYLAVLNGADAIIFTAGVGENATDVREDVISGISWFGCDVDPEKNVFGVTGDISTSAA
KVRVLVIPTDEELVIARDVERLKNK

KEGG   T30302 (Metagenome): 13088
Entry
13088             CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
got:AXE85_04905 (best score: 276.174)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.13088-T1-C
LinkDB
Position
C471207:complement(2..436)
AA seq 145 aa
EKYGVRKYGAHGTSHRYIGEKVAEILGKDSKELKTISCHIGNGASICAIKNGKSFDTSMG
FTPLSGLVMGTRTGDIDPATIPYIAQKTGLSLEEIVRIFNFESGLKGVSALSSDLRDVEA
ARSTNPHAAEAIDVYINRIKEYVGA

KEGG   T30302 (Metagenome): 1641
Entry
1641              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
spy:SPy_0109 (best score: 160.229)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1641-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1713:complement(2..301)
AA seq 100 aa
MTKTIAINAGSSSLKWQLYLMPEEKVLAKGLIERIGLKDSISTVKFDGRSEQQILDIENH
TQAVKILLDDLIRFDIIKAYDEITGVGHRVVAGGEYFKES

KEGG   T30302 (Metagenome): 18057
Entry
18057             CDS       T30302                                 

Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
elm:ELI_2893 rho:RHOM_09880 (best score: 52.7582)
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.18057-T1-C
LinkDB
Position
C481141:complement(1..90)
AA seq 30 aa
MNVLVVNCGSSSLKYQLIDMEHEVVLAKGQ

KEGG   T30302 (Metagenome): 20164
Entry
20164             CDS       T30302                                 

Definition
acetate kinase A and propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
hin:HI1204 (best score: 239.58)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.20164-T1-C
LinkDB
Position
C484617:517..1008
AA seq 164 aa
LYFSLPVNLFYTLKGVFYIGFILRSFEWILLTSIKNRVPMSKLVLILNCGSSSLKFAILD
PATGEEKLSGLAEAFYLPEARIKWKLNGEKGSADLGAGAAHTEALNFIASNIMTDELKNS
ITSIGHRIVHGGEKYTQSVIVTDEVVKGIEDAAQFAPLHNPAHL

KEGG   T30302 (Metagenome): 20233
Entry
20233             CDS       T30302                                 

Definition
acetate kinase A and propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
hin:HI1204 (best score: 345.895)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.20233-T1-C
LinkDB
Position
C484723:480..1022
AA seq 181 aa
MSKLVLILNCGSSSLKFAILDPATGEEKLSGLAEAFFLPEARIKWKLNGEKGSADLGAGA
AHTEALDFIASNIMTDELKNSITSIGHRIVHGGEKYTQSVVITDEVVKGIEDAAQFAPLH
NPAHLIGIREAFKTFPHLKDKNVAVFDTAFHQTMPEGAFLYALPYSLYKEHAVRRYGAHG
T

KEGG   T30302 (Metagenome): 20668
Entry
20668             CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 396.356)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.20668-T1-C
LinkDB
Position
C485363:complement(1..684)
AA seq 228 aa
MKVCFKKEEKFMLILVVNAGSSSLKYQVRDTSAPEAEQMITSGLIENIGTDVPDHEVALH
MMAEKLEGVLHGRQLQAIGHRVVQGAEKFTHPVLLNEQVIDEIDALSPLAPLHNPAHVKG
MRAAFHTWPDLPQVAVFDTAFHSTMPEHAWRYAIPYDLADKYSIRRYGFHGTSHEYVSHV
AADMLGIARDEFNGVVAHLGNGASVTAVKGGKSVDTSMGYTPLAGLVM

KEGG   T30302 (Metagenome): 2219
Entry
2219              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L73818 (best score: 226.098)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.2219-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2272:1..507
AA seq 169 aa
SITAINGGKSVDTSMGFTPLAGVMMGTRTGDIDPAIIPYLMQYTEDFNTPEDISRVLNRE
SGLLGVSAKSSDMRDIEAAVEAGDHDATLAYEMYVDRIQKYIGQYLAVLNGADAIIFTAG
VGENAAHFREKVISGITWFGCDVDPEKNVFGSTGDISTEEAKIRVLVIP

KEGG   T30302 (Metagenome): 5052
Entry
5052              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L73818 (best score: 200.675)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.5052-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4754:complement(2..409)
AA seq 136 aa
MPEKAYRYPLPTKYYTENKVRKYGAHGTSHQFVAGEAAKLLGRPLEDLKLITCHIGNGAS
ITAVKGGQSVDTSMGFTPLGGVMMGTRTGDIDPAIIPYLMQYTEDFNTPEDISHVLNRES
GLMGVSGKSSDMRDVI

KEGG   T30302 (Metagenome): 5812
Entry
5812              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
got:AXE85_04905 (best score: 164.466)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.5812-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5307:1..273
AA seq 90 aa
RIKEYVGAYAAAMNGVDAIVFTAGVGENATWVREEVLEGLTFLGVQIDKEKNNVRGKVAE
ISTADSKVKAFVIPTDEEVMIARDTYNLSK

KEGG   T30302 (Metagenome): 6857
Entry
6857              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
rmu:RMDY18_01260 (best score: 126.716)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.6857-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5875:complement(1597..1818)
AA seq 73 aa
LIFTAGIGENSGDFRKLVLDRLAPLGIRYNEEENMKRSPEPRLISTEDSSIAVFVIPTNE
EKAIAEATEELVA

KEGG   T30302 (Metagenome): 7486
Entry
7486              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
got:AXE85_04905 (best score: 191.045)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.7486-T1-C
LinkDB
Position
C458155:3..305
AA seq 101 aa
KLTKLGIVQDVKEIEGVGHRVVHGGEFYDASVLVTDEELAKVDSIEDLAPLHNPANIKGV
RSFQKELPGVPNVLTFDTAFHQSMPKSTYMYAVPREFYEKY

KEGG   T30302 (Metagenome): 7983
Entry
7983              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
lla:L0224 (best score: 144.05)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.7983-T1-C
LinkDB
Position
C459315:complement(2..313)
AA seq 104 aa
YVAHEAAKLLGKPIEELKLITCHIGNGASITAVDKGLSVDTSMGFTPLGGVMMGTRTGDI
DPAIIPYLMQHTDDFKTPEDISRILNRESGLLGVSEKSSDMRDI

KEGG   T30302 (Metagenome): 8808
Entry
8808              CDS       T30302                                 

Gene name
ackA
Definition
acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Best hit
got:AXE85_04905 (best score: 218.009)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00680  Methane metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.8808-T1-C
LinkDB
Position
C461306:complement(3..326)
AA seq 108 aa
EKYGVRKYGAHGTSHRYIGEKVAEILGKDPKELKTISCHIGNGASICAIKNGKSFDTSMG
FTPLSGLVMGTRTGDIDPATIPYIAQKTGLSLEEIVRIFNFESGLKGV

DBGET integrated database retrieval system