KEGG   T30302 (Metagenome): 10081
Entry
10081             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
vpr:Vpar_0162 (best score: 193.356)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10081-T1-C
LinkDB
Position
C464342:1..318
AA seq 105 aa
GQIAPVFSISAGLDYPGIGPEHAYLHDSGRAQYVPITDDEAVDAFEYLSRMEGIIPAIES
AHAVAHAMRLAPTLGPDESIIICLSGRGDKDVAAMARYRGVNLHE

KEGG   T30302 (Metagenome): 10618
Entry
10618             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
vpr:Vpar_0162 (best score: 98.2117)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10618-T1-C
LinkDB
Position
C465586:complement(3..173)
AA seq 57 aa
MTTHRHGYFGDFGGQFMPETLMNAIIELEAAYEMYKNDPEFIKELEDLHVSYTGRPS

KEGG   T30302 (Metagenome): 11372
Entry
11372             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 65.0846)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11372-T1-C
LinkDB
Position
C467290:complement(283..384)
AA seq 33 aa
EPNKEQILVVNLSGRGDKDIFTVDKILTEKGMK

KEGG   T30302 (Metagenome): 12585
Entry
12585             CDS       T30302                                 

Gene name
trpB2
Definition
tryptophan synthase beta chain 2
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
fnu:FN0317 (best score: 224.557)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12585-T1-C
LinkDB
Position
C470121:3..422
AA seq 140 aa
ESRRQILDKEGRLPDYVIACVGGGSNAIGAFSQYVADEEVKLVGVEAAGRGLDTDQHAAT
MTKGSVGVVDGMKTYAVFAEDGQVAPVYSISAGLDYPGVGPEHAFFKDSGRVEYVAATDD
EAVDALLLLTQKEGILPAIE

KEGG   T30302 (Metagenome): 12776
Entry
12776             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
vpr:Vpar_0162 (best score: 263.077)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12776-T1-C
LinkDB
Position
C470543:1..426
AA seq 142 aa
LNNVLGQMLLAKRMGKTRVIAETGAGQHGVATATVAALMGMECEIFMGQEDCERQALNVY
RMELLGAKVHPVTSGTGTLKDAVSETMREWTNRMADTHYVLGSVMGAHPFPMMVRDFQSI
ISREAREQILEKEGKLPAAVLA

KEGG   T30302 (Metagenome): 16406
Entry
16406             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 399.438)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16406-T1-C
LinkDB
Position
C478067:1..597
AA seq 199 aa
IPVQKGSCSLKDACCEAMRDWSANYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQI
LEKEGRLPDAVIAAVGGGSNAIGMFTDFIDEKGVRLIGVEPAGHGIESGEHGAPLGHAKV
GIYFGMKSPLMQTEDGQVEESYSISAGLDFPSVGPQHAYLQSIGRAEYPSITDDEALNAF
QELAKHEGIIPALESSHAL

KEGG   T30302 (Metagenome): 19028
Entry
19028             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08280 (best score: 497.664)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19028-T1-C
LinkDB
Position
C482797:28..834
AA seq 269 aa
MSENLADAFLEGKSLKNAPGPYFGQYGGRWMPESLIAAMDELESTFQNAKQDPEFIAEFQ
RLSAEYSNRPSLLTEVPRFSEHAGARIFLKREDLNHTGSHKINNVLGQALLAKRMGKTRL
IAETGAGQHGVATATAAALFGMDCVIYMGEEDTERQALNVARMQLLGAKVIAVQNGSRTL
KDAINEALRDWVANVENTHYLLGTAAGAHPFPTMVRFFHDAIGSEAREQIQQMTGRLPHG
VSACVGGGSNAIGIFHAFLDDRDVKLYGF

KEGG   T30302 (Metagenome): 20804
Entry
20804             CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08280 (best score: 269.24)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20804-T1-C
LinkDB
Position
C485563:complement(655..1143)
AA seq 162 aa
AATINLGRPGMLHGAVTYLMQDEDGQTIESHSISAGLDYPGVGPEHSYLSDLGRVSYQPV
TDTEAMDAFQLLCRTEGIIPAIESAHALAGALRVCQEWAHQDSESAREKIMVVCLSGRGD
KDMETALKWFDLGKATPSSSLMTGNKEAVAEKAVQAESEAHA

KEGG   T30302 (Metagenome): 27
Entry
27                CDS       T30302                                 

Definition
tryptophan synthase beta chain 2
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
adc:FOC79_07740 (best score: 215.312)
Taxonomy
Firmicutes - Bacilli [GN:adc]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.27-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_35:complement(509..949)
AA seq 146 aa
VDAAFGAWMNDLEAFYVLGSAVGPHPYPTIVHEFQKVISEESRRQILEKEGRLPDYVIAC
VGGGSNAIGAFSQYVADEEVKLVGVEAAGHGLDTDKHAATMTKGSIGIVDGMKTYAVFKE
DGELAPVYSISAGLDYPXXXXXYPSD

KEGG   T30302 (Metagenome): 2796
Entry
2796              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
spn:SP_1812 (best score: 99.7525)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2796-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2836:235..375
AA seq 47 aa
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEE

KEGG   T30302 (Metagenome): 2844
Entry
2844              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
gsa:FOC50_03835 (best score: 370.548)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2844-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2881:complement(145..738)
AA seq 197 aa
TIVKDFQKVISKEAKRQILEKEGRLPDLVVACVGGGSNAIGAFAEFIPHKEVALLGVEAA
GRGLDTDRHAATLTLGTVGVVDGMKTYALFNEDGSVKPVYSISPGLDYPGIGPEHSFLKD
AKRAEYVSATDDEAVDALLLLTRTEGIIPAIESSHALAEVIKRAPKLDKDKVIIVNVSGR
GDKDVAAIADYLENRNK

KEGG   T30302 (Metagenome): 3342
Entry
3342              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
spn:SP_1812 (best score: 126.716)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3342-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3350:complement(385..648)
AA seq 87 aa
MYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQILEAFSISAGLDYPGIGP
EHXXDKDVVQVKDRLEADAAKKGEAHA

KEGG   T30302 (Metagenome): 3343
Entry
3343              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
spn:SP_1812 (best score: 101.679)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3343-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3350:complement(666..863)
AA seq 65 aa
LFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRXXXXXXXXX
SSIHL

KEGG   T30302 (Metagenome): 3498
Entry
3498              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
gsa:FOC50_03835 (best score: 70.0922)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3498-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3495:complement(3..113)
AA seq 37 aa
MTNLENNLNNLKGYFGEFGGSFVPEVVQKALDELEAA

KEGG   T30302 (Metagenome): 4792
Entry
4792              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 92.0485)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.4792-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4530:complement(989..1135)
AA seq 48 aa
ESSHALAHALKMVHQEPNKEQILVVNLSGRGDKDIFTVDKVLKEKGMQ

KEGG   T30302 (Metagenome): 8934
Entry
8934              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 218.009)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8934-T1-C
LinkDB
Position
C461606:2..331
AA seq 110 aa
SLKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGIETKRQILEREGRLP
DAVIAAVGGGSNAIGMFTDFIDEANVRLIGVEPAGKGIESGEHGAPLGHA

KEGG   T30302 (Metagenome): 9629
Entry
9629              CDS       T30302                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
hin:HI1431 rpne:NCTC8284_02079 (best score: 229.565)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9629-T1-C
LinkDB
Position
C463270:3..344
AA seq 114 aa
NYAGRPTALTLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAET
GAGQHGVATALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSC

DBGET integrated database retrieval system