KEGG   T30302 (Metagenome): 10189
Entry
10189             CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
hin:HI0222 (best score: 233.417)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.10189-T1-C
LinkDB
Position
C464588:complement(2..355)
AA seq 118 aa
LLLHRAIGKNLHCVFVDNGLLRLHEGDQVMEMFGNKFDLNITRVDAESRFLGELTGVSDP
EAKRKIIGKVFVDVFDDESKKLTNVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVG

KEGG   T30302 (Metagenome): 12200
Entry
12200             CDS       T30302                                 

Gene name
guaA
Definition
tRNA methyl transferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
got:AXE85_01615 (best score: 261.151)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.12200-T1-C
LinkDB
Position
C469227:complement(2..409)
AA seq 136 aa
GDQKVLCALSGGVDSSVVAALLDKAIGDQLICMFIDHGLLRKGEAEAVMNTFSKEIEGGF
NMNLIKVDARERFLGKLKGVSDPEQKRKIIGNEFVYVFDEECAKLHDVPFLAQGTLYTDV
IESGTKNAQTIKSHHN

KEGG   T30302 (Metagenome): 15886
Entry
15886             CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing), N-terminal domain
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
vpr:Vpar_0181 (best score: 346.665)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.15886-T1-C
LinkDB
Position
C477077:2..565
AA seq 188 aa
DFGGQYNQLIARRVRENNVYCEVYPYNKALEKIKELQPKGIIFTGGPASVYEDNAPKMEA
EVFELGIPVLGMCYGMQFMAHTLGGHVTSAETREFGKTPTHVDVSSPLFKGLSEEEIVWM
SHVDYVAKVPEGFKIVAHTKDCPVAAMQNEERRLYAMQYHAEVLHTEHGKEMLHNFLYIV
CGCTGQWT

KEGG   T30302 (Metagenome): 16684
Entry
16684             CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase C terminal domain
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
vpr:Vpar_0181 (best score: 249.98)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16684-T1-C
LinkDB
Position
C478593:3..377
AA seq 124 aa
PFPGPGLAIRVMGEVTKDKLDVLRDADYIFRDEIAKAGLDRSINQYFAVLTSTRTVGVMG
DFRTYDYTLALRGVTTTDFMTADWARIPYDVLDTISRRIVNEVNHINRIVYDITSKPPAT
IEWE

KEGG   T30302 (Metagenome): 22894
Entry
22894             CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
hin:HI0222 (best score: 134.806)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.22894-T1-C
LinkDB
Position
C488051:complement(2292..2483)
AA seq 63 aa
GRKYDWVISLRAVETIDFMTAHWAHLPYDLLGKVSNRIINEVNGISRVVYDISGKPPATI
EWE

KEGG   T30302 (Metagenome): 2482
Entry
2482              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
tur:AT726_05090 (best score: 91.2781)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2482-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2513:complement(3..137)
AA seq 45 aa
VKFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMQFELIEPL

KEGG   T30302 (Metagenome): 2483
Entry
2483              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
spy:SPy_1204 (best score: 125.176)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2483-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2513:complement(234..497)
AA seq 87 aa
IPADFVRTGTSADCPYAAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWT
MDNFIDMQIQKIRETXXXXXXGSRSSS

KEGG   T30302 (Metagenome): 3155
Entry
3155              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
got:AXE85_01615 (best score: 230.72)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.3155-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3176:complement(92..439)
AA seq 115 aa
RVLGEVTEEKLQIVRDSDFILRDVIAKRGLEGEIWQYFTCLPDIRSVGVMGDVRTYDYTV
AVRAVTSIDGMTASWAHIPFEVLEEISARIVNEVAHVNRVVYDITSKPPATIEWE

KEGG   T30302 (Metagenome): 4826
Entry
4826              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
got:AXE85_01615 (best score: 226.098)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.4826-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4558:complement(2..376)
AA seq 125 aa
GGKVESATSREYGAHNVDVTPGAKLFEGTPASQQVLMSHSDKVVELAEGFKVVATSDNCP
IAAAENVEKDFYCFQFHPEVRHSEYGYDLIKNFIRNVCKCTENWTIQNFIDEKIEEIRAE
VGDQK

KEGG   T30302 (Metagenome): 5755
Entry
5755              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
aap:NT05HA_0517 (best score: 336.265)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5755-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5276:3..512
AA seq 170 aa
DVTEQQIREFNPDGIILSGGPESTTEENSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGL
TETSDHREFGYASVLMDNPTALFAHLNDGDSKLDVWMSHGDKVTRLPENFQVTGTTPTCS
IAAMSDENRRFYGVQFHPEVTHTKKGLELLMNFVVNICGCETKWTAENII

KEGG   T30302 (Metagenome): 7177
Entry
7177              CDS       T30302                                 

Gene name
guaA
Definition
tRNA methyl transferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
vpr:Vpar_0181 (best score: 189.119)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.7177-T1-C
LinkDB
Position
C457413:3..299
AA seq 99 aa
IEEIRNTVGDGKVLLALSGGVDSSVAAALISKAVGDQLTCIFVDHGLMRKNEGDEVEAAF
KDSGMHFIRVDAEERFLTKLAGLEDPEAKRKAIGEEFIR

KEGG   T30302 (Metagenome): 9665
Entry
9665              CDS       T30302                                 

Gene name
guaA
Definition
GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Best hit
hin:HI0222 (best score: 230.335)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.9665-T1-C
LinkDB
Position
C463368:3..344
AA seq 114 aa
LLLHRAIGKNLHCVFVDNGLLRLHEGDQVMEMFGDKFGLNITRVDAESRFLGELAGVSDP
EAKRKIIGKVFVDVFDDESKKLTNVKWLAQGTIYPDVIESAASKTGKAHVIKSH

DBGET integrated database retrieval system