KEGG   T30302 (Metagenome): 10405
Entry
10405             CDS       T30302                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
hin:HI0465 (best score: 216.083)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10405-T1-C
LinkDB
Position
C465082:complement(33..362)
AA seq 109 aa
QENIGFEVAGKFVKYSDNGSTLSSVNFPEVSLPEHEGTKRLLHIHENRPGILNKLNQIFV
EANLNIAAQYLQTDPKIGYVVVDVETNDASPLLMKLKEIDGTIRARVLY

KEGG   T30302 (Metagenome): 20609
Entry
20609             CDS       T30302                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
hin:HI0465 (best score: 282.337)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20609-T1-C
LinkDB
Position
C485287:665..1096
AA seq 144 aa
MTNKVSLDKSKIKFVLFEGVHQSALDTLHAAGYTNIDYYKKALDGNELKEAIKDAHFIGL
RSRTHLTAEMIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGE
ILLLMRNVPRANAEVHRGVWNKSA

KEGG   T30302 (Metagenome): 3181
Entry
3181              CDS       T30302                                 

Gene name
pdxB
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
rpne:NCTC8284_03974 (best score: 297.36)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3181-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3207:1..498
AA seq 166 aa
FYDIENKLPLGNAKQLHTLEELLGSCDVISLHVPDLPSTRNLMSAERIAQLKQDSILINA
ARGTVVDIDALAAALEQGKVRGAAIDVFPVEPASINEEFISPLRKFDNVILTPHIGGSTA
EAQENIGFEVAGKFVKYSDNGSTLSSVNFPEVSLPEHACAKRLLHI

KEGG   T30302 (Metagenome): 6940
Entry
6940              CDS       T30302                                 

Gene name
serA
Definition
phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
hin:HI0465 (best score: 230.335)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6940-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5900:complement(3..392)
AA seq 130 aa
LINKNKEANMTNKVSLDKSKIKFVLLEGVHQSALDTLHAAGYTNIDFYKKALDGDELKEA
IKDAHFIGLRSRTQLTAEMIEAAPKLIAIGCFCIGTNQVDLNAAKMRGIPVFNAPFSNTR
SVAELVLGEI

KEGG   T30302 (Metagenome): 7215
Entry
7215              CDS       T30302                                 

Definition
hypothetical protein
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Best hit
elm:ELI_1356 (best score: 115.546)
Taxonomy
Firmicutes - Clostridia [GN:elm]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7215-T1-C
LinkDB
Position
C457503:1..300
AA seq 100 aa
MEPLGVSETLLQSLAEPFKAEGYELVVYGTKETNQIKLLDRVRQASIIILANQPLSGEII
RQCPKLEFISVAFTGVDHIDLEACHEKGIIVSNAAGYSTQ

DBGET integrated database retrieval system