KEGG   T30302 (Metagenome): 10467
Entry
10467             CDS       T30302                                 

Gene name
devB
Definition
6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
hit:NTHI0685 (best score: 242.662)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.10467-T1-C
LinkDB
Position
C465228:complement(2..364)
AA seq 121 aa
GKSMNTIIFPTAQHVVEKIAQEFVIYSQLNRPVHISLSGGSTPKLLFKTLAKSPYAEQIN
WKNLHFWWGDDRMVPPSDPESNYGEVQKLLFDHIQIPAENIHRIRGENEPHFELKRFEEE
L

KEGG   T30302 (Metagenome): 4279
Entry
4279              CDS       T30302                                 

Definition
raw score 14.83
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
hit:NTHI0685 (best score: 150.599)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.4279-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4139:1627..1845
AA seq 73 aa
MNTITFPTAQHAVEKIAEEFVIYSQLNHPVHISLSGGSTPKLLFKTLAQTPYAEQINWKN
LHFWWGDDRMVPP

KEGG   T30302 (Metagenome): 12626
Entry
12626             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
vpr:Vpar_1447 (best score: 126.716)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.12626-T1-C
LinkDB
Position
C470213:complement(73..423)
AA seq 116 aa
KESIDLVLLGLGDDGHTASLFPKSEALYERNRMVVAVKDGKVWERVTLTFPMLVNAKSVW
FTVVGASKEAALARVLRQRKEYEEYSWEDRVDHCLPGAVLTHEPVEWYVDDSAHKN

KEGG   T30302 (Metagenome): 4687
Entry
4687              CDS       T30302                                 

Definition
6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
hit:NTHI0685 (best score: 237.269)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.4687-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4439:3..365
AA seq 120 aa
RFEEELSAVIPNGVFDWIILGMGTDGHTASLFPHQTNFDDENLAVIAKHPESGQIRISKT
AKLIEQAKRITYLVTGETKADILKEIQTTPAENLPYPAAKIKAKNGVTEWYLDKAAAKLL

KEGG   T30302 (Metagenome): 10311
Entry
10311             CDS       T30302                                 

Gene name
pgl
Definition
6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
vpr:Vpar_1447 (best score: 127.102)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.10311-T1-C
LinkDB
Position
C464864:complement(1..360)
AA seq 120 aa
RFLTYTNECIAETGACVVAVSGGTTPNALFSLLDSDEYTNRIDWEHIFFLWVDERFVPQS
NPDNNFGRAKDRLFGNIMGAAHYYPVPTNNGTVEEAADKYEQEVQMVLKRTEKESIDLVL

KEGG   T30302 (Metagenome): 1116
Entry
1116              CDS       T30302                                 

Definition
carboxy-cis,cis-muconate cyclase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
spn:SP_1506 (best score: 167.162)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1116-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1203:133..381
AA seq 83 aa
MKETVYFGTYTRRTSQGIYKADFDTETGLLSNLELFATEPSPTYLAFDQHQHLYTVGSQD
DKGGIAAYQTDGTLLNHVVEEGA

KEGG   T30302 (Metagenome): 3713
Entry
3713              CDS       T30302                                 

Definition
6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
got:AXE85_01595 (best score: 136.346)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.3713-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3700:complement(283..582)
AA seq 99 aa
KGSAIKISNDNRFIYVSNRGQDAVVVFENTESGLKQLQTISTEGEGPRDFDLSKDNNLAI
ATNENSGTITVYAVNKKTGELIVVASEVVVPEAVCAKFI

KEGG   T30302 (Metagenome): 1524
Entry
1524              CDS       T30302                                 

Definition
6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Best hit
got:AXE85_01595 (best score: 139.428)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1524-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1606:54..422
AA seq 123 aa
LENVIIIVYKVGGKIMVRAYIGTYTKQDSEGIYLVELSEEGKVLEVRNVAKVDNPTYLAL
SNDNKYLYSVSRVEGKGAVTSFEVEENGDLKELTSVAQEGNPPCYVELNSNKNILLSANY
HLG

DBGET integrated database retrieval system