KEGG   T30302 (Metagenome): 1052
Entry
1052              CDS       T30302                                 

Definition
glucokinase (glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
lla:L84096 (best score: 213.772)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1052-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1138:549..1049
AA seq 166 aa
LGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGEL
GHITVDFDQPIACTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAK
TVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIXXXXXX

KEGG   T30302 (Metagenome): 5099
Entry
5099              CDS       T30302                                 

Definition
ROK family sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Best hit
got:AXE85_00565 (best score: 221.09)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.5099-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4790:2..415
AA seq 137 aa
GVGEIGQSVYDFDTKTTYEQRASTIALDRKIKAEMYEGLSVIEFFDLCKREDTSALKVLD
EWLFELARGIVNLLCILDPKYIVIGGAVSAQGDYLLNKLEAKVRELHPIENNQTKFLAAE
LGNDAALYGAISPFVEK

DBGET integrated database retrieval system