KEGG   T30302 (Metagenome): 10555
Entry
10555             CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
myi:110449620 (best score: 79.3369)
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.10555-T1-C
LinkDB
Position
C465430:complement(29..364)
AA seq 111 aa
LEEHYGHIKDKPFFESTMQYMMSGPVIMGILTCDNESDVTHAREVLGNTNPEKADKNTLR
GRFGIVEGDIIKNVAHLSDSFESGEHEIEIWKDILFRSQPTITERKIESHQ

KEGG   T30302 (Metagenome): 12876
Entry
12876             CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
rdn:HMPREF0733_12074 (best score: 144.436)
Taxonomy
Actinobacteria [GN:rdn]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.12876-T1-C
LinkDB
Position
C470753:complement(1..219)
AA seq 73 aa
MTEKTLILVKPDGVGRGLIGEILSRFETKGYVIEGLKMLQPTEELLAQHYAEHAGKPFYR
SLVDFMVSGPVVA

KEGG   T30302 (Metagenome): 23022
Entry
23022             CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
rhey:FEE42_11210 (best score: 230.335)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.23022-T1-C
LinkDB
Position
C488181:complement(474..893)
AA seq 139 aa
MTERTFSIIKPDAVKRHLIGAILGRFEAQGFRVVALKMVQLTKEQAEGFYAEHQGKPFFE
PLVEYMMSGPMVVSVLEKENAVKDYRTLIGATNPAEAAEGTIRKDFALSQRENSVHGSDS
VESAKREIAYFFVDSEIQP

KEGG   T30302 (Metagenome): 23195
Entry
23195             CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
rhey:FEE42_11210 (best score: 230.72)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.23195-T1-C
LinkDB
Position
C488335:1576..1998
AA seq 140 aa
MTERTLSIIKPDAVNRHLMGAILARFEQAGFKIIATKMIHLTREQAEGFYAEHQGKVFFE
PLINYMISAPILVSVLEKENAIKDYRTLIGNTNPETAEEGTIRKEFALSQRENSVHGSDS
IESAKREIAYFFVDSEIYTY

KEGG   T30302 (Metagenome): 4705
Entry
4705              CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
lgr:LCGT_0920 (best score: 150.214)
Taxonomy
Firmicutes - Bacilli [GN:lgr]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.4705-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4456:1..339
AA seq 112 aa
EQRGFTIEKLELRTKVSEELIDQHYQDLVGQSFYPPIREFMTSGPVLVGIISGPKVIETW
RTMMGATRPEEALPGTIRGDFAKAAGENEVIQNVVHGSDSEESAKREIALWF

KEGG   T30302 (Metagenome): 5797
Entry
5797              CDS       T30302                                 

Gene name
ndk
Definition
nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Best hit
lgr:LCGT_0920 (best score: 56.225)
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04016  MAPK signaling pathway - plant
Other DBs
HMP: SRS016196.5797-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5297:complement(243..353)
AA seq 36 aa
IRGDFAKAAGENQAIQNVVHGSDSEESAKREIALWF

DBGET integrated database retrieval system