KEGG   T30302 (Metagenome): 10596
Entry
10596             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Best hit
vpr:Vpar_0752 (best score: 223.787)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10596-T1-C
LinkDB
Position
C465534:complement(1..366)
AA seq 122 aa
LKDAVDLPIHLHTHEGSGNAIYSYGRAVDAGVDIIDLAYSAFANGTSQPSMSSMYYGLTG
HDRQPTMNVDYMEEASNYFGSIRPYYKGVDHTSSYPNTTVYQHEMPGGQYSNLQQQAKSV
GL

KEGG   T30302 (Metagenome): 11966
Entry
11966             CDS       T30302                                 

Gene name
pyc
Definition
pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Best hit
vpr:Vpar_0752 (best score: 233.802)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11966-T1-C
LinkDB
Position
C468677:complement(1..402)
AA seq 134 aa
REVTKYEELRDAYDRAKSEAKMAFGDDDVYVEKLIVEPKHIEVQIIGDEHGNIVHLHERD
CSIQRRHQKVVEVAPAFALSRDLRDRICAAAVKIMKHVNYVSAGTVEFLVTADGNFYFIE
VNPRIQVEHTVTEM

KEGG   T30302 (Metagenome): 19341
Entry
19341             CDS       T30302                                 

Gene name
pyc
Definition
pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Best hit
vpr:Vpar_0752 (best score: 433.721)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19341-T1-C
LinkDB
Position
C483335:complement(3..875)
AA seq 291 aa
KSVGLGERWEDIKRVYHEVSMLFGDIIKVTPSSKIVGDMTLFMVQNNLTEQDIYDKGDTL
DFPQSVVEFFKGYIGTPYLGFPERLQQIVLKGEKPLDGRPGAMLPSVDFEAVRKELAEKG
AGTTDEDVIAHCLYSKVFADYSTFKHDYSDVSVLDTPTFFFGMKRGESVEVTIEQGKTLV
IKYIQMSEADEDGTRHVLFELNGQPRTIKIHDKHIKTTGVVRHKVDPTKPGEVGATLSGS
VVKIVAQVGQAVKKGDALVVTEAMKMETTITAPVSGVVGVIHVREGSRIES

KEGG   T30302 (Metagenome): 10553
Entry
10553             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Best hit
vpr:Vpar_0752 (best score: 202.216)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10553-T1-C
LinkDB
Position
C465426:complement(1..366)
AA seq 122 aa
KDKDRGTKLLRYIADVTVNGYNGHKEEVPTFEPLIMPSNVPGAPAAGTKQKLDELGPEKF
SKWVQEQPKVLFTDTTWRDAHQSLFATRLRTADMARVAGHVAKGLPNLFSLECWGGATFD
VA

DBGET integrated database retrieval system