KEGG   T30302 (Metagenome): 10828
Entry
10828             CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
rmu:RMDY18_05380 (best score: 228.794)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.10828-T1-C
LinkDB
Position
C466038:1..372
AA seq 124 aa
DEAFALLSKNKIERLPLIDEAGKLAGLITLKDFVKTEQYPRATKDDDGRLRVGAAIGFFG
DGYERAMALVEAGVDALFVDTANGHSQGVLDMISRLKKDPAAAHVDVIGGQAATREGAQA
IIDA

KEGG   T30302 (Metagenome): 1336
Entry
1336              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
got:AXE85_01775 (best score: 210.305)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.1336-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1424:1..327
AA seq 109 aa
VKTLRTNYPNLDIIAGNVATGEAARDLFEAGADVVKVGIGPGSICTTRVVAGVGVPQITA
IYDCATVARELGKTIIADGGIKYTGDVVKAIAAGGHAVMLGSMLAGCEE

KEGG   T30302 (Metagenome): 13984
Entry
13984             CDS       T30302                                 

Definition
IMP dehydrogenase family protein
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
rmu:RMDY18_05390 (best score: 275.404)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.13984-T1-C
LinkDB
Position
C473103:complement(3..470)
AA seq 156 aa
VMSPATAIALGKLGGLGVLNLEGLWTRYEDPQPLLDEITELPEADPASATTRMQQIYAEP
IKPELITARLEEIRDSGVIVAGSLTPQNTQEHYETVVQAGADLFVIRGASVSAEHISTSH
EPLNLKKFIYELDVPVMVGGVAGYTQAKHLMRTGAA

KEGG   T30302 (Metagenome): 16470
Entry
16470             CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
mht:D648_14140 (best score: 78.9517)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.16470-T1-C
LinkDB
Position
C478183:3..119
AA seq 38 aa
IEELRTKAEFVRISGAGIKESHVHDVTITKEAPNYRMG

KEGG   T30302 (Metagenome): 18507
Entry
18507             CDS       T30302                                 

Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
rmu:RMDY18_05380 (best score: 315.079)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.18507-T1-C
LinkDB
Position
C481899:complement(3..533)
AA seq 177 aa
MTVPTALTDDPFGFTGLTYDDVLLLPGNTDVIPSDADTSTRLSKRITLGTPIISAAMDTV
TDSQMAISMARLGGMGVIHRNLSIEDQAAHVDRVKRSESGMIINPVTIGADATIGEYDNL
CGYYKVSGLPVVTEDGKLEGIITNRDIRYLSRSDYENTLVRDVMTPMPLITGSPNLT

KEGG   T30302 (Metagenome): 2005
Entry
2005              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
got:AXE85_01775 (best score: 259.61)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.2005-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2039:complement(3..449)
AA seq 149 aa
VTEHKMAIAMAREGGLGVIHKNMSIEEQAEQVRKVKRSESGVITDPFFLTPDSLVYEAEE
LMQQYRISGVPIVNNEKDMKVVGIITNRDMRFLTDFDIKISEVMTKEHLITAPEKTTLEE
ASEILRSHKIEKLILTNEEGKLTGLITIK

KEGG   T30302 (Metagenome): 2241
Entry
2241              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
got:AXE85_01775 (best score: 221.476)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.2241-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2289:complement(674..1018)
AA seq 114 aa
PGELEIFQGRTFKAYRGMGSISAMEKGSKDRYFQEDGKKLVPEGIEGRTPYKGAVSETIY
QIIGGLRAGMGYTGSRDLRALRENSQFVRMTGAGLIESHPHDVQITKESPNYSK

KEGG   T30302 (Metagenome): 2461
Entry
2461              CDS       T30302                                 

Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
sgn:SGRA_p0005 (best score: 58.5362)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.2461-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2498:complement(3..98)
AA seq 32 aa
MDTVTESQMAIAIARAGGLGVIHKNMSIAQQA

KEGG   T30302 (Metagenome): 4409
Entry
4409              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
got:AXE85_01775 (best score: 72.0182)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.4409-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4242:467..577
AA seq 37 aa
MWENKFQKEGLTFDDVLLVPAKSDILPKKVDLKVSLT

KEGG   T30302 (Metagenome): 8361
Entry
8361              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
hin:HI0221 (best score: 201.83)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.8361-T1-C
LinkDB
Position
C460234:3..320
AA seq 106 aa
VKKFESGIVSEPVTVSPNLTLAELAEMVKKNGFAGYPVVDSENNLIGIITGRDTRFVKDL
SKTVSQVMTKKEDLVTVKEGASREEILELMHQHRVEKVLVVNDSFK

KEGG   T30302 (Metagenome): 8814
Entry
8814              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
msu:MS0774 (best score: 151.754)
Taxonomy
Gammaproteobacteria - Others [GN:msu]
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.8814-T1-C
LinkDB
Position
C461316:92..328
AA seq 79 aa
MLRIKQEALTFDDVLLVPAHSTVLPNTANLSTQLTKEIRLNIPMLSAAMDTVTETKLAIS
LAQEGGIGFIHKNMTIERQ

KEGG   T30302 (Metagenome): 9088
Entry
9088              CDS       T30302                                 

Gene name
guaB
Definition
inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Best hit
mht:D648_14140 (best score: 78.9517)
Pathway
00230  Purine metabolism
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.9088-T1-C
LinkDB
Position
C461966:3..119
AA seq 38 aa
IEELRTKAEFVRISGAGIKESHVHDVTITKEAPNYRMG

DBGET integrated database retrieval system