T30302 (Metagenome): 1087 Help Entry 1087              CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthetase, central domain   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit spy:SPy_1359 (best score: 159.073) Taxonomy Firmicutes - Bacilli [GN:spy]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.1087-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_1177:3..344 AA seq 114 aa AA seqDB search ADLRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEVSNEQIHNDVINKVI KEVIPASYLDEQTKXXXXXXGAFSGKDATKVDRSASYAARYIAKNIVAXXXXXX

T30302 (Metagenome): 12344 Help Entry 12344             CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit vpr:Vpar_0845 (best score: 209.92) Taxonomy Firmicutes - Others [GN:vpr]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.12344-T1-C LinkDB All DBs Position C469557:3..353 AA seq 116 aa AA seqDB search KVDRSAAYAARYVAKNIVAAGLADKCEVQVAYAIGVAKPVSIMVETFGTAKIEEEKISAL VSKHFDLRPAGIIEMLDLLKPHYKKTAAYGHFGRTDVDLPWERTDKAEVLRKEAGL

T30302 (Metagenome): 15750 Help Entry 15750             CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit paet:NCTC13378_01377 (best score: 177.948) Taxonomy Gammaproteobacteria - Others [GN:paet]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.15750-T1-C LinkDB All DBs Position C476821:3..275 AA seq 90 aa AA seqDB search CEIQLSYAIGVAEPTSIMVETFGTGKVSNEVLVKLVREFFDLRPYGLIKMLNLIQPIYRQ TAAYGHFGREQFPWEKVDRAEELRAAAGLK

T30302 (Metagenome): 16243 Help Entry 16243             CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit vpr:Vpar_0845 (best score: 331.643) Taxonomy Firmicutes - Others [GN:vpr]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.16243-T1-C LinkDB All DBs Position C477741:complement(3..584) AA seq 194 aa AA seqDB search TGQVHVVGEITTNTYVDIPHIVRDTIREIGYTRAKFGFDADTCGVNVAIDEQSADIAMGV DEALESREGGSDAFDKIGAGDQGMMFGFASNETEELMPMPISLAHRLSRQLTKVRKDNTL DYLRPDGKTQVTVEYVDGKPKRIETIVISTQHGPEVTLEQIQADIKKYVIDPVLPEGFID ENTKYFINPTGRFV

T30302 (Metagenome): 17425 Help Entry 17425             CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthetase, N-terminal domain   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit rmu:RMDY18_11270 (best score: 304.679) Taxonomy Actinobacteria [GN:rmu]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.17425-T1-C LinkDB All DBs Position C480031:complement(1..471) AA seq 157 aa AA seqDB search VSNNHLRLFTSESVTEGHPDKICDQISDAILDGIIAQDSTANVAVETMVTTGQVHVAGEV TTSSYVEIPSIVRETILGIGYDSSTRGFDGEFCGVSVSIGEQSPDINAGVYESLEARSGI AVDDYDRQGAGDQGIMFGYASNETNVLMPAPIWLAHR

T30302 (Metagenome): 22291 Help Entry 22291             CDS       T30302                                  Gene name metK Definition methionine adenosyltransferase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit hin:HI_1172 (best score: 422.165) Taxonomy Gammaproteobacteria - Others [GN:hin]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.22291-T1-C LinkDB All DBs Position C487405:1082..1741 AA seq 220 aa AA seqDB search MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS AWVDIENLTRQVICDIGYKHSDMGFDGNSCAVLNAIGKQSSDINQGVDRENPLDQGAGDQ GIMFGYATNETEVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVG VDAVVLSTQHSEEVSQKEIYEGVMEEIIKPILPSEWLSQQ

T30302 (Metagenome): 22698 Help Entry 22698             CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit hin:HI_1172 (best score: 304.679) Taxonomy Gammaproteobacteria - Others [GN:hin]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.22698-T1-C LinkDB All DBs Position C487849:complement(2..454) AA seq 151 aa AA seqDB search MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS AWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQ GIMFGYATNETDVLMPAAITYAHRLMEKQAE

T30302 (Metagenome): 3310 Help Entry 3310              CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit spy:SPy_1359 (best score: 201.83) Taxonomy Firmicutes - Bacilli [GN:spy]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.3310-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_3322:3..338 AA seq 112 aa AA seqDB search GGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVR IDTFGTGTVAESKLEKAARQIFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRT

T30302 (Metagenome): 3503 Help Entry 3503              CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit got:AXE85_07215 (best score: 283.493) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.3503-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_3501:complement(3..476) AA seq 158 aa AA seqDB search PDKIADQVSDAILDAILEQDPYGRVACETCVNTGLAVLVGEVSTTANVDFQQIVRDTINE IGYTDPNKGYSGDHISVLVGLDKQSPDIALGVDNSLETKQQKEENEVGAGDQGLMFGFAT NETPTFMPLPIYLSQKLSKQLAEVRKNGTLSYLGPDGK

T30302 (Metagenome): 541 Help Entry 541               CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit pmu:PM1027 (best score: 196.823) Taxonomy Gammaproteobacteria - Others [GN:pmu]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.541-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_632:3..380 AA seq 125 aa AA seqDB search IGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKXXXXXXXXXIGVADPTSIMVETFGTG KVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFPWEKVDRAAELRV AAGLK

T30302 (Metagenome): 6207 Help Entry 6207              CDS       T30302                                  Gene name metK Definition S-adenosylmethionine synthase   KO K00789   S-adenosylmethionine synthetase [EC:2.5.1.6] Best hit got:AXE85_07215 (best score: 101.679) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00270   Cysteine and methionine metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01230   Biosynthesis of amino acids 01240   Biosynthesis of cofactors Other DBs HMP:  SRS016196.6207-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_5555:1..168 AA seq 55 aa AA seqDB search IKEEFRLTPNGIIETLDLRKPIFKKTAAYGHFGREDVEFTWERTDKVEAFKKLLK

DBGET integrated database retrieval system