KEGG   T30302 (Metagenome): 10910
Entry
10910             CDS       T30302                                 

Gene name
accB
Definition
acetyl-coA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
hin:HI0971 (best score: 167.933)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.10910-T1-C
LinkDB
Position
C466216:complement(2..373)
AA seq 124 aa
MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPAVAPAAVQYAAAPVVAPTPTAAP
AQAPAAATSAPAASDELSGHLVRSPMVGTFYRSPSPEAKAFVEVGQSVKVGDALCIVEAM
KMMN

KEGG   T30302 (Metagenome): 12658
Entry
12658             CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxyl carrier protein subunit
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
spy:SPy_1747 (best score: 101.293)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12658-T1-C
LinkDB
Position
C470295:2..187
AA seq 61 aa
GPDKPAFVNVGDQVKKGQTLMIIEAMKVMNEVPAPKDGIITEVLVQNEEMVEFGKGLVRI
K

DBGET integrated database retrieval system