KEGG   T30302 (Metagenome): 110
Entry
110               CDS       T30302                                 

Definition
starch synthase catalytic domain
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
spn:SP_1124 (best score: 46.9802)
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.110-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_194:complement(2..70)
AA seq 23 aa
MKAGILYADRVSTVSPSYAHEIM

KEGG   T30302 (Metagenome): 111
Entry
111               CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
spn:SP_1124 (best score: 139.043)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.111-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_194:complement(117..482)
AA seq 121 aa
LGDVIGALPKSLVKAGHEVAVILPYYDMVKAKFGNQIEDILHFEVCVGWRRQYCGIKKTV
LNGVTFYFMTTNIISSVVMFTVILMTENALPFSNLLPLRLWKGLTLSLIFSMFMTXVWSW
L

KEGG   T30302 (Metagenome): 12380
Entry
12380             CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
hin:HI1360 (best score: 240.35)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.12380-T1-C
LinkDB
Position
C469635:complement(3..416)
AA seq 138 aa
GVDLLIESVDEIVKQGSQLMILGSGAPHFEQGIRELAERYPQNVAVKIGYDETLSHLLVA
GGDVILVPSRFEPCGLTQLYGLQYGTLPLVRKTGGLADTVVDSTPENIKDRTATGFVFEQ
ATAEDLRRSIQQVFDIWQ

KEGG   T30302 (Metagenome): 14182
Entry
14182             CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
got:AXE85_04275 (best score: 286.189)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.14182-T1-C
LinkDB
Position
C473521:complement(3..479)
AA seq 159 aa
THQKGIDLVLHVADEILKTGAQLVILGTGDRHYEDALRSLEYRRHDKVRSLIMFSSEVSS
KVYSSCDMFLMPSKTEPCGLSQLISMRYATVPIVHRVGGLRDTVEPFDGKSGTGFTFESF
DAYDMLDAVYRATYCYYQERHIWNKIMTNAIKQDVSWKK

KEGG   T30302 (Metagenome): 14856
Entry
14856             CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
got:AXE85_04275 (best score: 306.605)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.14856-T1-C
LinkDB
Position
C474941:complement(3..512)
AA seq 170 aa
KFQEELALEVNENIPMIGMVTRLTHQKGIDLVLHVADEILKTGAQLVILGTGDRHYEDAL
RSLEYRRHDKVRSLIMFSSEVSSKVYSSCDMFLMPSKTEPCGLSQLISMRYATVPIVHRV
GGLRDTVEPFDGKSGTGFTFESFDAYDMLDAVYRATYCYYQERHIWNKIM

KEGG   T30302 (Metagenome): 15237
Entry
15237             CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
spn:SP_1124 (best score: 233.032)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.15237-T1-C
LinkDB
Position
C475737:complement(84..530)
AA seq 148 aa
GTGDPAFEQAFAWFGQAYPDKLSANILFDVGLAQEIYAASDIFLMPSRFEPCGLSQMMAM
RYGTLPLVHEVGGLRDTVEPYNVYTGQGTGFSFNNFSGYWLSWTFKEALNLYTHDKEAWK
SMQEQAMERDFSWDTASLAYSDLYQSLL

KEGG   T30302 (Metagenome): 5529
Entry
5529              CDS       T30302                                 

Gene name
glgA
Definition
starch synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Best hit
got:AXE85_04275 (best score: 481.1)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.5529-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5118:243..1061
AA seq 273 aa
MKILFVAAEAAPFVKVGGLGDVIGSLPKALQDENVEARVVLPLYSSIDRDKYDLKYRQHI
FINLGWRTVYCGIFETVINGVTYYFIDNEQYFNRDSVYGQDDDGERFAFFSKAALEILPH
IDYKPDVVNANDWHAALSIIYLDDLKARGEGFYQDIKSVISIHNIEFQGKFNPYEMGNLF
GLDNKYFDALIYKGDLNLLKGAIQLADRINTVSETYAHEILDPYFSYGLDDILRVEQGKL
HGIINGLDTDKFNSKTDKLIFKNFDIKTLKNKV

DBGET integrated database retrieval system