KEGG   T30302 (Metagenome): 11018
Entry
11018             CDS       T30302                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 192.971)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.11018-T1-C
LinkDB
Position
C466482:complement(3..377)
AA seq 125 aa
KCPGCKHTIYQKDLGSDRVCPNCGYTFRITALERLALTVDEDTFEELFTGIETKDPLNFP
NYKDKLAQMREKTGLDEAVLTGTASIKGHKTALGIMDSNFIMASMGSVVGEKITRLFEYA
TELRL

KEGG   T30302 (Metagenome): 12156
Entry
12156             CDS       T30302                                 

Definition
acetyl-coA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 88.9669)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12156-T1-C
LinkDB
Position
C469143:complement(269..409)
AA seq 46 aa
EFLLEKGAIDMIVKRSEMRKTLASVLSKLTNQPSPFVEPELISEDE

KEGG   T30302 (Metagenome): 1838
Entry
1838              CDS       T30302                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 211.46)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1838-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1902:453..821
AA seq 123 aa
VTGTALIKGQTVALGIMDSNFIMASMGTIVGEKITRLFEYATIEKLPVVLFTASGGARMQ
EGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFA
GRR

KEGG   T30302 (Metagenome): 18618
Entry
18618             CDS       T30302                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
paet:NCTC13378_00651 (best score: 215.698)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.18618-T1-C
LinkDB
Position
C482109:1..363
AA seq 120 aa
LMQMAKTSAVLAKMREKGVPFISVLTDPTLGGVSASFAMLGDVNIAEPKALIGFAGPRVI
EQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRSTLGNLLSKLTNQPSPFVEVEVVEHE

KEGG   T30302 (Metagenome): 19162
Entry
19162             CDS       T30302                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 328.946)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19162-T1-C
LinkDB
Position
C483031:complement(2..553)
AA seq 184 aa
MSWIDRIFSKGTSSSASRKANVPEGVWTKCTSCEQVLYGEEVKRNLYVCPKCGHHMRIDA
RERLLALLDEGSSQELSADLEPKDILKFKDLKKYKDRITAAQKETGEKDALITMTGTLYN
MPVVVAASNFSFMGGSMGSVVGAKFVKAAEKAMELNCPFVCFSASGGARMQEALFSLMQM
AKTS

KEGG   T30302 (Metagenome): 19342
Entry
19342             CDS       T30302                                 

Definition
acetyl-coA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 275.018)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19342-T1-C
LinkDB
Position
C483337:complement(1..417)
AA seq 139 aa
MSWINRIFSKSPSSSTRKANVPEGVWTKCTSCEQVLYSEELKRNLYVCPKCGHHMRIDAR
ERLLKLLDEGSSQEIAADLEPKDILKFKDLKKYKDRISAAQKETGEKDALITMTGTLYNM
PIVVAASNFAFMGGSMGSV

DBGET integrated database retrieval system