KEGG   T30302 (Metagenome): 1110
Entry
1110              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 93.5893)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1110-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1199:complement(4..303)
AA seq 99 aa
GIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFINTAGAYPGVGAXXXX
XXXXKFYLCHSQSRRFCFHSMEGWYSCHGSGRTDENHFA

KEGG   T30302 (Metagenome): 1463
Entry
1463              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 115.546)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1463-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1534:3..344
AA seq 114 aa
NSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEAGLSSKELIKS
VKKELQTELAMLSQKPLEALLEERYQRFRKYXFLLCIKEEVKGAWKTKHLFDYS

KEGG   T30302 (Metagenome): 3989
Entry
3989              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
rpne:NCTC8284_01263 (best score: 538.495)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.3989-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3932:1412..2350
AA seq 313 aa
MSQEYLDFELPIAELEAKIEALRSASDDKIDLHDEIKRLQKKSDELTRKTFANLDAWQVS
RMARHPNRPYTLDYIEHIFTDFQELAGDRAFADDKAIVGGLARLDGRAVMIIGHQKGRTV
KDKVTRNFGMPAPEGYRKALRLMQMAERFNLPIITFIDTPGAYPGIGAEERGQSEAIARN
LREMSTLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKA
STAAEVMGLTATRLKELGLIDNIVQEPLGGAHRNYHEMARNLKQCLVEELNELDTFDKDG
LLERRYERLMSYG

KEGG   T30302 (Metagenome): 6832
Entry
6832              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI0406 (best score: 493.812)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.6832-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5864:complement(3..893)
AA seq 297 aa
VVIDLFFSYYFLRYLSSPTSENHLRHTLILDXXXXXXXXXQEYLDFELPIAELEAKIEAL
RAASDDKVDLTDEIKRLQKKSNELTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEF
EELAGDRAFANDKAIVGGLARLDGRPVMVIGHQKGRSVKEKVQRNFGMPAPEGYRKALRL
MEMAERFKLPIITFIDTPGAYPGIGAEERGQAEAIARNLREMAQLTVPVICTVIGEGGSG
GALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKASTAAEVMGLTASRLKELNL

DBGET integrated database retrieval system