KEGG   T30302 (Metagenome): 1110
Entry
1110              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 93.5893)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1110-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1199:complement(4..303)
AA seq 99 aa
GIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFINTAGAYPGVGAXXXX
XXXXKFYLCHSQSRRFCFHSMEGWYSCHGSGRTDENHFA

KEGG   T30302 (Metagenome): 6832
Entry
6832              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI0406 (best score: 493.812)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.6832-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5864:complement(3..893)
AA seq 297 aa
VVIDLFFSYYFLRYLSSPTSENHLRHTLILDXXXXXXXXXQEYLDFELPIAELEAKIEAL
RAASDDKVDLTDEIKRLQKKSNELTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEF
EELAGDRAFANDKAIVGGLARLDGRPVMVIGHQKGRSVKEKVQRNFGMPAPEGYRKALRL
MEMAERFKLPIITFIDTPGAYPGIGAEERGQAEAIARNLREMAQLTVPVICTVIGEGGSG
GALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKASTAAEVMGLTASRLKELNL

KEGG   T30302 (Metagenome): 3989
Entry
3989              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
rpne:NCTC8284_01263 (best score: 538.495)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.3989-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3932:1412..2350
AA seq 313 aa
MSQEYLDFELPIAELEAKIEALRSASDDKIDLHDEIKRLQKKSDELTRKTFANLDAWQVS
RMARHPNRPYTLDYIEHIFTDFQELAGDRAFADDKAIVGGLARLDGRAVMIIGHQKGRTV
KDKVTRNFGMPAPEGYRKALRLMQMAERFNLPIITFIDTPGAYPGIGAEERGQSEAIARN
LREMSTLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKA
STAAEVMGLTATRLKELGLIDNIVQEPLGGAHRNYHEMARNLKQCLVEELNELDTFDKDG
LLERRYERLMSYG

KEGG   T30302 (Metagenome): 1463
Entry
1463              CDS       T30302                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 115.546)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1463-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1534:3..344
AA seq 114 aa
NSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEAGLSSKELIKS
VKKELQTELAMLSQKPLEALLEERYQRFRKYXFLLCIKEEVKGAWKTKHLFDYS

KEGG   T30302 (Metagenome): 10910
Entry
10910             CDS       T30302                                 

Gene name
accB
Definition
acetyl-coA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
hin:HI0971 (best score: 167.933)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.10910-T1-C
LinkDB
Position
C466216:complement(2..373)
AA seq 124 aa
MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPAVAPAAVQYAAAPVVAPTPTAAP
AQAPAAATSAPAASDELSGHLVRSPMVGTFYRSPSPEAKAFVEVGQSVKVGDALCIVEAM
KMMN

KEGG   T30302 (Metagenome): 12658
Entry
12658             CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxyl carrier protein subunit
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
spy:SPy_1747 (best score: 101.293)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12658-T1-C
LinkDB
Position
C470295:2..187
AA seq 61 aa
GPDKPAFVNVGDQVKKGQTLMIIEAMKVMNEVPAPKDGIITEVLVQNEEMVEFGKGLVRI
K

KEGG   T30302 (Metagenome): 21429
Entry
21429             CDS       T30302                                 

Definition
acetyl-coA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 199.519)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.21429-T1-C
LinkDB
Position
C486413:1..291
AA seq 96 aa
KVNHLHSPGGLGVRWDSHVYGGYTVPPHYDSMIAKLITYGDTREVAIRRMQNALSETIID
GIKTNIPLHELILEDENFQKGGTNIHYLEKKLGMHD

KEGG   T30302 (Metagenome): 8313
Entry
8313              CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 120.938)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.8313-T1-C
LinkDB
Position
C460126:complement(2..208)
AA seq 69 aa
MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLADEAICIGPAKSTDSY
LNMNAVLSA

KEGG   T30302 (Metagenome): 15070
Entry
15070             CDS       T30302                                 

Definition
biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 326.635)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.15070-T1-C
LinkDB
Position
C475397:3..521
AA seq 173 aa
AVHSTADRDLKHVLLADETVCIGPAPSAKSYLNIPAIIAAAEVTGADAIHPGYGFLSENA
DFAEQVERSGFTFIGPTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGPVSNDISKNKEIA
KRIGYPIIIKASGGGGGRGMRVVRSEGALEESIAMTKAEAKAAFNNDMVYMEK

KEGG   T30302 (Metagenome): 1836
Entry
1836              CDS       T30302                                 

Definition
biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 157.147)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1836-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1902:1..276
AA seq 91 aa
GVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFDALMKMQRALYELEIEGVQTNADFQ
LDLISDRNVIAGDYDTSFLMETFLPKYQEKE

KEGG   T30302 (Metagenome): 9045
Entry
9045              CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 166.007)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.9045-T1-C
LinkDB
Position
C461858:1..333
AA seq 111 aa
PGFGFLSENSKFATMCEEVGVKFIGPSGAIMDMMGDKINARAQMIKANVPVIPGSDGEVF
TAEEALEVAEKIGYPVMLKASAGGGGKGIRKVEKAEDLVAAFESASSEAKA

KEGG   T30302 (Metagenome): 22016
Entry
22016             CDS       T30302                                 

Definition
acetyl-coA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 322.783)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.22016-T1-C
LinkDB
Position
C487111:3..500
AA seq 165 aa
FYFIEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGLPLSYKQEDIKVKGHAMECRINAED
PKTFLPSPGKVAHLHSPGGLGVRWDSHVYAGYTVPSHYDSMIAKLITYGDTRDVAIRRMQ
NALSETIIDGIKTNIPLHELILEDENFQKGGANIHYLEKKLGMYD

KEGG   T30302 (Metagenome): 968
Entry
968               CDS       T30302                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 115.931)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.968-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1069:1..258
AA seq 85 aa
EALVVAEKIGYPVMLKASAGGGGKGIRKVEKPEDLVSAFETASSEAKANYGNGAMYIERV
IYPARHIEVQILGDXXXXXXKCRNH

KEGG   T30302 (Metagenome): 14668
Entry
14668             CDS       T30302                                 

Gene name
accC
Definition
biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
rhey:FEE42_05910 (best score: 311.612)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.14668-T1-C
LinkDB
Position
C474553:complement(1..501)
AA seq 167 aa
LLADETVCIGPAPSVKSYLNIPAIIAAAEVTGADAIHPGYGFLSENADFAEQVERSGFIF
IGPTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGPVGSDIAKNKEIAKRIGYPIIIKASG
GGGGRGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRH

KEGG   T30302 (Metagenome): 1838
Entry
1838              CDS       T30302                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 211.46)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1838-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1902:453..821
AA seq 123 aa
VTGTALIKGQTVALGIMDSNFIMASMGTIVGEKITRLFEYATIEKLPVVLFTASGGARMQ
EGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFA
GRR

KEGG   T30302 (Metagenome): 19162
Entry
19162             CDS       T30302                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 328.946)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19162-T1-C
LinkDB
Position
C483031:complement(2..553)
AA seq 184 aa
MSWIDRIFSKGTSSSASRKANVPEGVWTKCTSCEQVLYGEEVKRNLYVCPKCGHHMRIDA
RERLLALLDEGSSQELSADLEPKDILKFKDLKKYKDRITAAQKETGEKDALITMTGTLYN
MPVVVAASNFSFMGGSMGSVVGAKFVKAAEKAMELNCPFVCFSASGGARMQEALFSLMQM
AKTS

KEGG   T30302 (Metagenome): 18618
Entry
18618             CDS       T30302                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
paet:NCTC13378_00651 (best score: 215.698)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.18618-T1-C
LinkDB
Position
C482109:1..363
AA seq 120 aa
LMQMAKTSAVLAKMREKGVPFISVLTDPTLGGVSASFAMLGDVNIAEPKALIGFAGPRVI
EQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRSTLGNLLSKLTNQPSPFVEVEVVEHE

KEGG   T30302 (Metagenome): 12156
Entry
12156             CDS       T30302                                 

Definition
acetyl-coA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 88.9669)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12156-T1-C
LinkDB
Position
C469143:complement(269..409)
AA seq 46 aa
EFLLEKGAIDMIVKRSEMRKTLASVLSKLTNQPSPFVEPELISEDE

KEGG   T30302 (Metagenome): 19342
Entry
19342             CDS       T30302                                 

Definition
acetyl-coA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI1260 (best score: 275.018)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19342-T1-C
LinkDB
Position
C483337:complement(1..417)
AA seq 139 aa
MSWINRIFSKSPSSSTRKANVPEGVWTKCTSCEQVLYSEELKRNLYVCPKCGHHMRIDAR
ERLLKLLDEGSSQEIAADLEPKDILKFKDLKKYKDRISAAQKETGEKDALITMTGTLYNM
PIVVAASNFAFMGGSMGSV

KEGG   T30302 (Metagenome): 11018
Entry
11018             CDS       T30302                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 192.971)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.11018-T1-C
LinkDB
Position
C466482:complement(3..377)
AA seq 125 aa
KCPGCKHTIYQKDLGSDRVCPNCGYTFRITALERLALTVDEDTFEELFTGIETKDPLNFP
NYKDKLAQMREKTGLDEAVLTGTASIKGHKTALGIMDSNFIMASMGSVVGEKITRLFEYA
TELRL

KEGG   T30302 (Metagenome): 17495
Entry
17495             CDS       T30302                                 

Definition
acetyl-coA carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 129.028)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.17495-T1-C
LinkDB
Position
C480165:complement(3..233)
AA seq 77 aa
VTHNPAKAIKNFTAVPGHHTGPVSKILIANRGEIAVRIIRAARDEGLETVAVYAEPDRDA
QHVKLADEAYALGGATA

KEGG   T30302 (Metagenome): 9584
Entry
9584              CDS       T30302                                 

Definition
acetyl-coA carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 208.764)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.9584-T1-C
LinkDB
Position
C463164:2..343
AA seq 114 aa
RFLDSPRHIETQCLADAHGNVQVVSTRDCSLQRRNQKLVEEAPAPYLTEEQSDRLYEASR
KILQEAGYQGAGTCEFLLAPDGAISFLEVNTRLQVEHPVSEEVSGIDLVREQFR

DBGET integrated database retrieval system