KEGG   T30302 (Metagenome): 11102
Entry
11102             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
hin:HI1357 (best score: 209.92)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.11102-T1-C
LinkDB
Position
C466654:3..350
AA seq 115 aa
NSPLFELDYSPEGFDWLVVDDAANSVFAFERRSSNGERIIVISNFTPVPRHNYRIGVNVA
GTYEEILNTDSMYYQGSNVGNFGYVTSEEIESHGRENSISISIPPLATVYLKYNL

KEGG   T30302 (Metagenome): 11982
Entry
11982             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
spn:SP_1121 (best score: 234.572)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.11982-T1-C
LinkDB
Position
C468717:complement(2..403)
AA seq 134 aa
QFAGLRNLLTYQICHPGKKLLFMGSEFGQFLEWKSEEQLEWSNLDDRMNKQMQGFTSALN
AFYKDNRPLWEIDLSYDGIEIIDADNVDQSVLSFIRKTEKGDMLVCVFNMAPVERKNFTI
GVPVAAIYEEVWNT

KEGG   T30302 (Metagenome): 12373
Entry
12373             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
hin:HI1357 (best score: 286.574)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.12373-T1-C
LinkDB
Position
C469621:complement(3..413)
AA seq 137 aa
RVDAVASMIYRDYSRAEGEWIPNQYGGRENLEAIEFLKHTNWKIHSEMAGAISIAEESTS
FAGVTHPSENGGLGFNFKWNMGWMNDTLAYMQLDPIYRQYHHNKMTFGMMYQYSENFVLP
LSHDEVVHGKYSLLDKM

KEGG   T30302 (Metagenome): 17392
Entry
17392             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
hin:HI1357 (best score: 445.662)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.17392-T1-C
LinkDB
Position
C479967:1..669
AA seq 223 aa
RVSLVGDFNYWDGRRHPMRFHPASGVWELFLPKTSLGQRYKFELIDCNGNLRLKADPYAF
RSELRPDTASEISMLPDVVEMTEQRRKANQRNQPISIYEVHLGSWRRNLENNFWLDYDQI
ADELIPYVKHMGFTHIEFLPLSEFPFDGSWGYQPLGLYSPTSRFGSPEAFRRLVKRAHDA
GINVILDWVPGHFPSDTHGLVAFDGTALYEHEDPREGYHQDWN

KEGG   T30302 (Metagenome): 18544
Entry
18544             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
spn:SP_1121 (best score: 472.626)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.18544-T1-C
LinkDB
Position
C481973:1..774
AA seq 258 aa
QEEVDGKVGYSFRVWAPNAQSVHLIGDFTNWYENQIPMARNEAGVWEVFTDLPKEGDIYK
YNVKRSSGQEILKIDPLAVYLEERPGTGAVIRTIPEKKWKDGLWLARRKRWGFFSRPVNI
YEVHAGSWKRNEDGSPYSFAQLKEDLIPYLVEMNYTHVEFMPLMAHPLGLSWGYQLMGYF
AFEHTYGTPEEFQDFVEECHLNNIGVIVDWVPGHFTINDDALAYYDGTPTFEYQDHDRAH
NYGWGALNFDLGKNQVQS

KEGG   T30302 (Metagenome): 19171
Entry
19171             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
aap:NT05HA_0750 (best score: 250.751)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.19171-T1-C
LinkDB
Position
C483051:397..855
AA seq 153 aa
MTKLVAQSVINSFFDGKHADPFAVLGMHETHNGIEVRALLPDADKVEVIDKESQSIVVVL
EKVDDRGFFTAIVPEIHHFFVYQLKVYWGAEAQIIEDPYRFHPMINDLDQWLLAEGSLLR
PYDVLGAHFSECDGVPGVNFRVWAPNAKRVSLV

KEGG   T30302 (Metagenome): 19565
Entry
19565             CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
got:AXE85_04260 (best score: 228.409)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.19565-T1-C
LinkDB
Position
C483681:482..904
AA seq 141 aa
MAEYLFHEGTNYHSHKFLGSFLDGDKCTFRVWAPNAKKVFVTGEFCSWNPRANEMKLVND
KGIYEIELFGINQYDAYKYVIVTKGGTELWKADPYAKHAETRPLTASKVYRLSEYEWNDS
KWMKSREVPYHRPMNIYEVHL

KEGG   T30302 (Metagenome): 2606
Entry
2606              CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
spn:SP_1121 (best score: 94.3597)
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.2606-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2659:3..164
AA seq 53 aa
QDHNKAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDGIRVDXXXXXXD

KEGG   T30302 (Metagenome): 2607
Entry
2607              CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
spn:SP_1121 (best score: 189.504)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.2607-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2659:139..459
AA seq 106 aa
MXXXXXXIKLVHPDVMMIAEESSSVTKITGMKELGGLGFDYKWNMGWMNDILRFYEEDPI
YRKYDFNLVTFSFMYVFKENYLLPFSHDEVVHGKKSMMHKXAVGMV

KEGG   T30302 (Metagenome): 5017
Entry
5017              CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
spn:SP_1121 (best score: 177.178)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.5017-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4728:complement(1..357)
AA seq 119 aa
MDKKKALETFMTGENFHLQHYLGAHRGEKAGESGYTFRVWAPNAQAXXXXXXXQEGQIYK
YNITRATGHQLMKIDPMAVRYEARPGTGAILTDIPEKKWKDGLWLARRKRWSFEERPVN

KEGG   T30302 (Metagenome): 5687
Entry
5687              CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
got:AXE85_04260 (best score: 388.652)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.5687-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5227:3..689
AA seq 228 aa
DPFFRKGVHNKFTFSMHYAFSENFILPISHDEVVHGKKSLLDKSPVPYEDKFGNFKAFLG
YMYAHPGKKLTFMGTDIAQFIEWDEERELDWLLMLYPKHVFTHRYVKELNKYYKSTPALW
ENDNDWDGFKWHVVDDSNNNVFAFSRKDRKGKEVLVVSNFSNQVLEHYEIGVDTWGSYKI
ALNSDAKKYDGIAITNRNLKTINKKKNEFKYTLSINIPPYTTMYIEKK

KEGG   T30302 (Metagenome): 9470
Entry
9470              CDS       T30302                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Best hit
got:AXE85_04260 (best score: 219.935)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016196.9470-T1-C
LinkDB
Position
C462890:complement(2..340)
AA seq 113 aa
GRELSYRELAHTLVDYVKEMHYTHIELLPVTEYPYDKSWGYQVTGYFAPTSRYGTPEDFM
YFVDCCHQNNIGVILDWVSGHFTKDAHGLYEFDGTHCYEYSDARKMEHEGWGT

DBGET integrated database retrieval system