KEGG   T30302 (Metagenome): 1117
Entry
1117              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 191.045)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1117-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1204:3..308
AA seq 102 aa
DDLSIILRSRELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKSHIGVTATAT
RALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAF

KEGG   T30302 (Metagenome): 11217
Entry
11217             CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 234.187)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11217-T1-C
LinkDB
Position
C466928:complement(3..380)
AA seq 126 aa
HPREAGILVSSEPGNARILPGSYDKLEELRESDEVLIIPGFFGVTSDNQICTFSRGGSDI
TGSIVAAGVKADLYENFTDVDGIFAAHPGVVHEPHSIPELTYKEMRELAYAGFSVLHDEA
LLPAYR

KEGG   T30302 (Metagenome): 18592
Entry
18592             CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
vpr:Vpar_1126 (best score: 95.9005)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18592-T1-C
LinkDB
Position
C482067:complement(2..166)
AA seq 55 aa
VALIVKKFGGSSVATPEKIFNIVNRVLRDKQPDDRIVVVVSAMGDTTDDLVSLAK

KEGG   T30302 (Metagenome): 19889
Entry
19889             CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 553.132)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19889-T1-C
LinkDB
Position
C484177:3..956
AA seq 318 aa
AGMITDGVHGAARLVEVNPDRIRRSVEAGNIAIVAGFQGVNRQSGDITTLGRGGSDTTAV
ALAAALHADVCEIYSDVDGVFTADPRIVSTAHKLNTVTSEEMLEMAANGAKILHLRSVEY
ARRFNLKLHVRSSFSNLEGTLVIPENSAELTPTHVKEIPLEQPLISGVAHDRGQAKITVV
GVPDIPGSAAKVFGLLNEAKINIDMIVQNVSTDRPNVTDISFTLNQAQGPQALQVLEKTQ
AEIGFEEVIYNEAVGKLSLVGAGMKTNPGVSFTFFEALSNAGVNVEMISTSEIRISVITE
LSKLDEAVRAVHTAFELD

KEGG   T30302 (Metagenome): 2034
Entry
2034              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
got:AXE85_01715 (best score: 207.994)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2034-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2073:complement(3..410)
AA seq 136 aa
YLTALLMAEYLGYHFVDAKDLIFYXXXXXXXXXXXXXPGFYGSRPNGEIKIMTRGGGDVS
GAIVANIANASVYENWTDVSGILMADPRIIENPHEIKVISYTELRELSYMGASVLHEEAI
FPVRDKDIPIQIRNTN

KEGG   T30302 (Metagenome): 20761
Entry
20761             CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 612.453)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20761-T1-C
LinkDB
Position
C485497:2..1075
AA seq 357 aa
LATLPIEDNLFLYDSFLAAGENNNAKLVAAFFNKNGLNARYIHPRDAGIFVSSEPGNARI
LPSSYDKIEELTNFEEVLVIPGFFGVTKDNQICTFSRGGSDITGSIIAAGVKADLYENFT
DVDGIFAAHPGIIHEPDSIPELTYREMRELAYAGFSVLHDEALIPAYRGKIPLVIKNTNN
PNHPGTKIILNHTDKAIPVVGIAGDSNFVSINMSKYLMNREVGFGRKVLQILEELNIRWE
HMPTGIDDLSIILRERELTPIKEEEILRQLTQKIEVDHAEIEHGLSIIMIVGEQMKSHIG
LTATATKALSDSKINIQMISQGSSEVSIMLVVNSEQEKAAIKALYEAFFNKHKKLEE

KEGG   T30302 (Metagenome): 21333
Entry
21333             CDS       T30302                                 

Definition
aspartokinase III
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 147.132)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21333-T1-C
LinkDB
Position
C486275:complement(3..254)
AA seq 84 aa
MSHLSVAKFGGTSVANYSAMQACAKIVIADPNTRVVVLSASAGVTNLLVALANGVEAEER
AKLIGEVRQIQENILNELKDDSRV

KEGG   T30302 (Metagenome): 2369
Entry
2369              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
got:AXE85_01715 (best score: 149.443)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2369-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2421:1..273
AA seq 90 aa
RPFIHELVAKIKSVLEADEINVTHEISLIATVGEKMKNTKGLSGRLFKALGEAGVNIALI
SQTNDEINIIVGVHNDDYEKTINTIYSEFK

KEGG   T30302 (Metagenome): 2739
Entry
2739              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 71.2478)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2739-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2780:3..116
AA seq 37 aa
MSQGSSEVSIMFVVHKDQEKAAIKALYNAFFGENKED

KEGG   T30302 (Metagenome): 2998
Entry
2998              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
got:AXE85_01715 (best score: 118.627)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2998-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3032:1287..1502
AA seq 72 aa
MVRVSKFGGSSVASAEQFKKVKNIVELDDARRFVVVSAVGKANKEDNKVTDLLYLCYAHT
KYNINFDNIFKM

KEGG   T30302 (Metagenome): 3425
Entry
3425              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 85.5001)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3425-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3425:complement(1..135)
AA seq 45 aa
VSVALTLDKTGSASSGAELLSTELLDELRQYCSVKVDTGLSLVAL

KEGG   T30302 (Metagenome): 3426
Entry
3426              CDS       T30302                                 

Definition
aspartokinase III
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
msu:MS1613 ooi:A6A10_05995 apl:APL_0710 mht:D648_13650 (best score:
100.908)
Taxonomy
Gammaproteobacteria - Others [GN:msu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3426-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3425:complement(132..302)
AA seq 56 aa
EAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQPXXXLHQK

KEGG   T30302 (Metagenome): 3783
Entry
3783              CDS       T30302                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 261.536)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3783-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3768:3..392
AA seq 130 aa
TRENQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPELTYRE
MRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLEHSSDKFPVVGIAGDS
GFVSINMSKY

KEGG   T30302 (Metagenome): 6111
Entry
6111              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 367.851)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6111-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5495:3..638
AA seq 212 aa
LKDDSRVRPVIEKYLENITALSEAASLATSLALTDELISHGEMMSTQIFIEVLRELQTNA
TWVDVRTLVATNDNFGKAAPDDAQTQTNCDNLLKPLIDRGELVITQGFIGREPGGKTTTL
GRGGSDYSAALLAEVLNAKDVLIWTDVAGIYTTDPRIVPNAQRIDTMSFAEAAEMATFGA
KVLHPATLLPAVRSNIPVYVGSSKAPEAGGTW

KEGG   T30302 (Metagenome): 7650
Entry
7650              CDS       T30302                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 116.701)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7650-T1-C
LinkDB
Position
C458533:3..194
AA seq 63 aa
EKMKSHIGVTATATRALSENKINIQMMSQGSSEVSIMFVVNKEQEKAAIKALYHAFFDES
KED

KEGG   T30302 (Metagenome): 8689
Entry
8689              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 199.134)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8689-T1-C
LinkDB
Position
C461034:complement(2..325)
AA seq 108 aa
LKDDSRVRPIIEKYLENITALSEAASLATSPALTDELISHGEMMSTQIFIEILREQNASG
TWVDVRTIVATNNHFGKAAPNDEQTQSNSDSILKPLIDRGELVITQGF

KEGG   T30302 (Metagenome): 9568
Entry
9568              CDS       T30302                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
got:AXE85_01715 (best score: 173.326)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9568-T1-C
LinkDB
Position
C463132:3..344
AA seq 114 aa
SDNKHLDEKQIVTGIAGKKDFSIITIKKRHMANEVGLIGKALKIFEDFNVSIEHIPSGID
SFSVVVETGNVRPFIHELVAKIKSVLEADEINVTHEISLIATVGERMKNTKGLS

DBGET integrated database retrieval system