KEGG   T30302 (Metagenome): 1129
Entry
1129              CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
spn:SP_1014 (best score: 184.882)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1129-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1209:complement(204..485)
AA seq 93 aa
EMHEMFTAIEESDMKKAAAIQRKFIPKVNALFSYPSPAPVKAVLNYMGFEAGPTRLPLVP
APEEDAKRIIKVVVDGDYEATKATVTGVLRPDY

KEGG   T30302 (Metagenome): 12330
Entry
12330             CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
hin:HI0255 (best score: 72.4034)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12330-T1-C
LinkDB
Position
C469531:2..124
AA seq 40 aa
KWAAYRLGLIKSAHLRLPLTVLSEEVQPKVEEALKIAGLL

KEGG   T30302 (Metagenome): 13203
Entry
13203             CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
rpne:NCTC8284_03476 (best score: 280.796)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13203-T1-C
LinkDB
Position
C471463:3..440
AA seq 146 aa
LFSGSIVALVTPMDNHGNIDFETLKKLIEFHIDAGTDSIVSVGTTGESATLSIEENVKVI
EKTVELAKGRIPIIAGTGANATSEAIVMTKLLRDSGVAGCLSVVPYYNKPTQEGMYQHFK
AIAECTDLPQLLYNVPGRTGSDMKPE

KEGG   T30302 (Metagenome): 15700
Entry
15700             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
dor:Desor_4606 (best score: 142.895)
Taxonomy
Firmicutes - Clostridia [GN:dor]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15700-T1-C
LinkDB
Position
C476733:complement(3..341)
AA seq 113 aa
MTTFGNILTAMITPFTDDGHVNFQEALRLAGYLLDNGSDGLIVCGTTGEGPNIDDRDKLE
LFTLIAKEYGHRATIIANTGSNSTKKSIALTKAASHTGVHGVMAVVPYYNKPN

KEGG   T30302 (Metagenome): 17891
Entry
17891             CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
rmu:RMDY18_14620 (best score: 416.001)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17891-T1-C
LinkDB
Position
C480857:complement(3..713)
AA seq 237 aa
LLTAMVTPFAQDGSVDEKQVAHLAEYLIDNGHDGLIVCGTTGEYSTMTDDENERVFAIVK
EAVGDRASIVAGVGSNDTAHTIELARRAEKVGVDGLLVVTPYYNKPTQHGVYAHFSTVAK
ATSTPIMLYDIPGRASIPIAPDTYRRLAELDNIVAVKDAKADFGAATDVMATTDLHYYSG
DDGLTLPWMAVGAVGLVSVTAHVAPMLFRELIDAVVAQDLVSAQRINLQLVPIVNAT

KEGG   T30302 (Metagenome): 18384
Entry
18384             CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
hin:HI0255 (best score: 458.759)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18384-T1-C
LinkDB
Position
C481705:3..758
AA seq 252 aa
LFSGSIVALVTPMNNYGEVDFACLEKLVEYHIEAGSNALVSVGTTGESATLSIEENVKVI
EKTVEFAKGRIPVIAGAGANATSEAITMTKLLRDSGVAGCLSVVPYYNKPTQEGIFQHFK
AIAECTDLPQILYNVPGRTGSDMKPETVARLSKINNIVGIKEATGDISRVTKIKELAGKD
FIVLSGDDATSLDAMKLGAEGVISVTNNLAPKDMADMCRYALAGDFAKAEEINARLMRLH
HDLFIESNPIPV

KEGG   T30302 (Metagenome): 21866
Entry
21866             CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
hin:HI0255 (best score: 252.292)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21866-T1-C
LinkDB
Position
C486949:complement(1046..1507)
AA seq 153 aa
GSDMKPETVARLSQIENIVGIKEATGDLTRITAIKELAGKDFIILSGDDATGLEAMKLGA
EGVISVTNNLAAKDMAAMCRYALASNFAKAEEINARLMRLHQDLFIESNPIPVKWAAYRL
GLIKTPHLRLPLTVLSESAQVKVEEALKVAGLI

KEGG   T30302 (Metagenome): 7377
Entry
7377              CDS       T30302                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Best hit
spn:SP_1014 (best score: 112.849)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7377-T1-C
LinkDB
Position
C457895:complement(2..178)
AA seq 59 aa
MAYKDLLNCKIITAFITPFHEDGSINFEAIPDLIEHLLAHHTDGILLAGTTAESPTLTH

DBGET integrated database retrieval system