KEGG   T30302 (Metagenome): 11300
Entry
11300             CDS       T30302                                 

Gene name
tyrA
Definition
T-protein
  KO
K14187  chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Best hit
rpne:NCTC8284_02115 (best score: 218.009)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
00401  Novobiocin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11300-T1-C
LinkDB
Position
C467116:2..382
AA seq 127 aa
ALDRELIQLFAKRLELVSQVGEIKHEKGLPIYAPDRELAMLQARREEADKAGISPQLIED
VLRRFMRESYSNENQFGFKTLNPAINKIVIVGGYGKMGQLFARYLRASGYPISILDRDDW
DVAARIL

KEGG   T30302 (Metagenome): 12579
Entry
12579             CDS       T30302                                 

Gene name
tyrA
Definition
T-protein
  KO
K14187  chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Best hit
hin:HI1290 (best score: 274.248)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
00401  Novobiocin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12579-T1-C
LinkDB
Position
C470111:3..422
AA seq 140 aa
VKREPLAKMLEIHTGAVLGLHPMFGPDIASMAKQVVVRCDGRFPERYEWLLEQIQIWGAK
VYQTDATEHDHNMTYIQALRHFSTFANGLHLSKQPVNLANLLSLSSPIYRLELAMIGRLF
AQDAELYADIIMDKPENLAV

KEGG   T30302 (Metagenome): 15915
Entry
15915             CDS       T30302                                 

Gene name
tyrA
Definition
T-protein
  KO
K14187  chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Best hit
hin:HI1290 (best score: 201.83)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
00401  Novobiocin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15915-T1-C
LinkDB
Position
C477113:complement(1..312)
AA seq 104 aa
MEALKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEA
EKAGISADLIEDVLRRFMRESYANENQFGFKTINSDIHKIVIVG

KEGG   T30302 (Metagenome): 19543
Entry
19543             CDS       T30302                                 

Definition
fused chorismate mutase T/prephenate dehydrogenase
  KO
K14187  chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Best hit
hin:HI1290 (best score: 409.068)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
00401  Novobiocin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19543-T1-C
LinkDB
Position
C483653:complement(203..901)
AA seq 232 aa
DVVIVSVPIDHTLETIERLKPYLTENMLLADLTSVKRIPLAKMLDVHKGAVVGLHPMFGP
DIASMAKQVVVRCDGRFSERYEWLLEQIQIWGAKIYQIDATEHDHNMTYIQALRHFSTFA
NGLHLSKQPVNLSNLLALSSPIYRLELAMIGRLFAQDAALYADIIMDKPENLDVIESLKQ
TYEEALQFFEKGDRQGFIDAFHQVREWFGEYSDQFLQESRQLLQQAHDLRHV

DBGET integrated database retrieval system