KEGG   T30302 (Metagenome): 11371
Entry
11371             CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
hin:HI1432 (best score: 181.415)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11371-T1-C
LinkDB
Position
C467290:complement(2..283)
AA seq 94 aa
MSHFETQFAALKAKNEGAFVPFVTLCDPTFDRSFDIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSTEDSFKLLEKVRSKYPE

KEGG   T30302 (Metagenome): 13689
Entry
13689             CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
hin:HI1432 (best score: 206.453)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13689-T1-C
LinkDB
Position
C472503:complement(119..460)
AA seq 113 aa
PNADEKTIQGVAQNSEGYTYLVSRAGVTSAENQAHAANLDTLVEQLKTHNAPPILQGFGI
AQPEQVKEALTLGAAGAISGSATVKIIEQNLDNPEQCLAELAEFVQAMKAATK

KEGG   T30302 (Metagenome): 15234
Entry
15234             CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
vpr:Vpar_0163 (best score: 115.546)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15234-T1-C
LinkDB
Position
C475727:complement(270..530)
AA seq 86 aa
SLGVTGMRSDITTDIASIVEQVRQYTDIPVAVGFGISTPEQAKAMAAVSDGAIVGSAIVK
QIGEWGPNGEQQLYKYVCSMVEAVGN

KEGG   T30302 (Metagenome): 20803
Entry
20803             CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08290 (best score: 347.436)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20803-T1-C
LinkDB
Position
C485563:complement(2..658)
AA seq 219 aa
MSYQDAQPHAAKYEVLDGTFPPQNPNSLLVQRLRECKEDGRAALIGYLPAGFPNFEDSVA
AAIELGNNGADIIELGVPYSDPVMDGPVIQHATGAALEGGFKLSRVFDAVRRITEATQSV
VVVMTYWNPVLAYGVDNFARDLAAAGGAGMITPDLVPDEASAWFEASEKYGLDRIFLAAL
SSSPQRLETIAKASSGFVYAVSVMGVTGARTSVSEAAQG

KEGG   T30302 (Metagenome): 3341
Entry
3341              CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
spn:SP_1811 (best score: 251.136)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3341-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3350:complement(3..392)
AA seq 130 aa
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLAGLAETINFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIQTEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPD

KEGG   T30302 (Metagenome): 4791
Entry
4791              CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0826 (best score: 501.516)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.4791-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4530:complement(162..989)
AA seq 275 aa
MSRFETKFAELAAKKEGAFVPFVTLCDPTFDRSFEIICTLVENGADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLAKVRSKYPEIPISLLLCANLIFAKGLDNFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADVKTVQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHKAPPILQGFGIAQPAQVKEALQLGAAGAISGSATVK
IIERNLDNQAQCLSELAEFVRNMKTAXXALLFFFY

KEGG   T30302 (Metagenome): 6635
Entry
6635              CDS       T30302                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08290 (best score: 102.834)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6635-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5769:complement(1699..1911)
AA seq 70 aa
SEAAQGLVENLHAAGAEYACVGLGVSTRAHVEEIGTYADGVIVGTALVKALADGGPTAVG
ALTRELAGRA

KEGG   T30302 (Metagenome): 8650
Entry
8650              CDS       T30302                                 

Gene name
trpA-1
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
csh:Closa_2560 (best score: 74.3294)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8650-T1-C
LinkDB
Position
C460936:2..229
AA seq 75 aa
GEKVSLENAPYQEILPLLKHYSKDPVYVGFGVKNAQDVSCIRDSGADGAIVGTEFLHQYE
LGGLSQIEQYLQSFQ

DBGET integrated database retrieval system