KEGG   T30302 (Metagenome): 11618
Entry
11618             CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lla:L0182 (best score: 169.088)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.11618-T1-C
LinkDB
Position
C467859:complement(3..392)
AA seq 130 aa
IGAKKAFAYDLIAACSGFVFALSTAEKLISSGVYQKGLVIGSETLSKVVDWSDRGTAVLF
GDGAGGVLLESTSDQHFLAEIQKTDGSRGESLTSCQIGLQSPFAQTEDDEKYLTMDGRAI
FDFAIRDVAQ

KEGG   T30302 (Metagenome): 12602
Entry
12602             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
hne:HNE_1162 (best score: 36.965)
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12602-T1-C
LinkDB
Position
C470163:complement(2..85)
AA seq 28 aa
MKHSFIIGTGSFLPNDPITNDELSEYFE

KEGG   T30302 (Metagenome): 13919
Entry
13919             CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
spy:SPy_1754 (best score: 151.369)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.13919-T1-C
LinkDB
Position
C472975:complement(89..469)
AA seq 126 aa
VISPYSDGTEQPNPYMQMDGKAIFDFAVKTVSKSIKALVEEKGDPDYFLLHQANIRILDI
MAKKIDVSRDKFLANMMSYGNTSAASIPILLSENVANGTLQLGSDQTILLSGFGGGLTWG
SLIVKI

KEGG   T30302 (Metagenome): 13927
Entry
13927             CDS       T30302                                 

Definition
3-oxoacyl-(acyl carrier protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
vpr:Vpar_0696 (best score: 95.9005)
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.13927-T1-C
LinkDB
Position
C472989:complement(2..175)
AA seq 58 aa
MLNKPVGIIGTGSYVPEKVLTNADLEKMVDTSDAWIQERTGIKERRIAPEGVNASDMA

KEGG   T30302 (Metagenome): 14388
Entry
14388             CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
scs:Sta7437_1317 (best score: 111.309)
Taxonomy
Cyanobacteria [GN:scs]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.14388-T1-C
LinkDB
Position
C473979:3..464
AA seq 153 aa
VQAAPEVSEDEYPYMCSFGSDGSQAQALYISDSTQQVVMDGAEVYMAAVDAMSEEITYVL
DSCGIDPERIDQLVCHQANGRIMAAVARRLRWDSSKVLSYIDRYGNTSAASIPITLAVGQ
QEGHVKPGDLLALTAFGAGFTWGAGVIGFKTTA

KEGG   T30302 (Metagenome): 1493
Entry
1493              CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
spy:SPy_1754 (best score: 69.3218)
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1493-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1564:1..273
AA seq 90 aa
AESLNSDGSRSECLTYGHSGLHSPFSDQENADSFLKMDGRAVFDFAIRDVAKSIKQTIDE
SPIEATDLDYLLLXXXXXXXXXXXFYFQSV

KEGG   T30302 (Metagenome): 17045
Entry
17045             CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
hin:HI0157 (best score: 400.593)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.17045-T1-C
LinkDB
Position
C479323:3..641
AA seq 213 aa
SGIRERRIAAADETVATMGFEAAKNAIEAAQINPQDIELIIVATTSNSHAYPSAACQVQG
LLNIDDAISFDLAAACTGFIYALSVADQFIRAGKVKKALVIGSDLNSRKLDETDRSTVVL
FGDGAGAVILESSEQEGIISTHLHASADKNNALVLAQPERGIEKSGYIEMQGNETFKLAV
RELSNVVEETLLANNLDKKDLDWLVPHQANLRI

KEGG   T30302 (Metagenome): 19596
Entry
19596             CDS       T30302                                 

Definition
3-oxoacyl-(acyl carrier protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
vpr:Vpar_0696 (best score: 183.726)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19596-T1-C
LinkDB
Position
C483731:2..364
AA seq 120 aa
EEGLTFIHMNGQEVYKFAVKTMGKTVLKALEMANMELEELDFFIPHQANTRIIKSAADRL
HLTEDKVFINLPKYGNTSAASIAIALDEAVRAGKLQKGDNLAVAGFGAGLTWASLVMKWC

KEGG   T30302 (Metagenome): 19781
Entry
19781             CDS       T30302                                 

Gene name
fabH1
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3 1
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rmu:RMDY18_11730 (best score: 303.908)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19781-T1-C
LinkDB
Position
C484013:2..484
AA seq 160 aa
GIAPTIWGSDGSRWGTVGMTHSLLDIRNRDFVANPVQEDEKIWPTLRQDGPSVFRWAVWE
MAKVAQQALESAGITPDELGALIPHQANARIIDQMAKTLKLPENVAIARDIADAGNTSAA
SVPLAAHRLLQEQPELSGKFALQIGFGAGLAYAAQVVVLP

KEGG   T30302 (Metagenome): 19874
Entry
19874             CDS       T30302                                 

Gene name
fabH1
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3 1
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rmu:RMDY18_11730 (best score: 314.309)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19874-T1-C
LinkDB
Position
C484155:396..953
AA seq 186 aa
VTTLKQYENNRYSRILGYGASRGEVIVHNNDIVEAINSSDEWIKQRTGISTRHRASENQT
VNDLAIAAAHDALANSHVTGEQIDAVIISTISHPYATPSLAVLVADAIGSRCPAYDISAA
CAGFCYGIAQADAMVRSGMAQNVLVIGVEKLSDFIDNTERSISFLLGDGAGAAVVSVSDE
PGIAPT

KEGG   T30302 (Metagenome): 20227
Entry
20227             CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
hin:HI0157 (best score: 548.895)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.20227-T1-C
LinkDB
Position
C484717:1..963
AA seq 320 aa
SFDIMNSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAADETVATMGC
EAAKKALEMANLDPQEIELIIVATTSGSHAYPSSACQVQGLLGIEDAISFDLAAACTGFV
YALGVADKFIRSGSVKKALVIGADLNSRKLDETDRSTVVLFGDGAGAVILEASEQEGIIS
THLHASPDNNAALLLPQAERGVEKSGYIEMQGNETFKLAVRELSNVVEETLSANNLQKTD
IDWLVPHQANLRIITATAKKLEMDMSQVVVTLDRTANTSAATVPTALDEAVRDGRIQRGQ
LLLLEAFGGGWTWGSALVRF

KEGG   T30302 (Metagenome): 40
Entry
40                CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lla:L0182 (best score: 129.413)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.40-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_48:929..1336
AA seq 136 aa
LNNLERKGYIERIRSEQDRRVVHLHLTKKGRLVHRLHXXXXXXVTNHDLAQIMDTNDEWI
SSRTGIRQRHISRTESTSDLATEVAKKLMTKAGITGEELDFIILATITPDSMMPSTAARV
QADIGANKAFAFDLTA

KEGG   T30302 (Metagenome): 9254
Entry
9254              CDS       T30302                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
hin:HI0157 (best score: 73.559)
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.9254-T1-C
LinkDB
Position
C462358:complement(2..112)
AA seq 37 aa
MNSRILSTGSYLPSYIRTNAELEKMVDTSDEWIVTRS

DBGET integrated database retrieval system