KEGG   T30302 (Metagenome): 1168
Entry
1168              CDS       T30302                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 338.961)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1168-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1245:3..536
AA seq 178 aa
QKSDRSFYDALAKGTHQKPAYILECKKASPSKGLIRGEFNLEEIANVYKHYASAVSVLTD
EKYFQGKFEYLPQVRDVVSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVL
ADLAHSLGMGVLTETSNEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTQKYAD

KEGG   T30302 (Metagenome): 14096
Entry
14096             CDS       T30302                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 293.893)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14096-T1-C
LinkDB
Position
C473327:complement(2..475)
AA seq 158 aa
HSKRCVSLRQAQELVTTAPLRFVGVFQNQELDFIAKIASQLQLYAVQLHGAENEAFITAL
RQQLPKNTQIWKAISVNTEVQSAVDFTDDLNVDRYIFDSQTENQQGGTGKTFDWSLIPEH
LKHKIILAGGISPNNVEQAIQQNCLGLDLNSGVESSAG

KEGG   T30302 (Metagenome): 18575
Entry
18575             CDS       T30302                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 315.849)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18575-T1-C
LinkDB
Position
C482039:275..778
AA seq 168 aa
MITQDFTKPIDSATVLQKIVLDKAQWVKAKETEFPLSQFKQNVQKSDRSFYAALAKGTHQ
KPAYILECKKASPSKGLIRAEFNLEDIANVYKHYAYAVSVLTDEKYFQGNFEFLPLVRGI
VSQPVLCKDFMISEYQVYLARYYQADAILLMLSVLNNETYRVLADLAH

KEGG   T30302 (Metagenome): 20599
Entry
20599             CDS       T30302                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 202.601)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20599-T1-C
LinkDB
Position
C485271:complement(733..1095)
AA seq 120 aa
FITALRHQLPEETQIWKAISVDTETQSAVDFTDDLNIARYIFDSQSANQQGGTGKTFNWS
LIPENLKHKIILAGGISPDNIEQAIKQGCLGVDLNSGVETAAGVKDSEKVRSVFKTILLN

DBGET integrated database retrieval system