KEGG   T30302 (Metagenome): 1173
Entry
1173              CDS       T30302                                 

Gene name
fabD
Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
spy:SPy_1750 (best score: 129.798)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1173-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1252:1..453
AA seq 151 aa
PANYNTPAQIVIGGEVVAVDRAVELVQEAGAKRLIPLKVSGPFHTALLESASQKLAETLA
QVSFSDFTCPLVGNTEAAXXVMQEAGVTNFIEIGPGKVLSGFVKKIDKXXXXXXXRKQEK
RMQLKNKNIFITGSSRGIGLAIAHKFAQAGA

KEGG   T30302 (Metagenome): 11967
Entry
11967             CDS       T30302                                 

Gene name
fabD
Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
hin:HI0156 (best score: 226.868)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.11967-T1-C
LinkDB
Position
C468679:1..402
AA seq 134 aa
NEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKEAVERAAALCKEAGAKRALPLAVSVP
SHCALMKPAAEQLAVTLEGIMLNAPGTPVLNNVDVKAETESAEIRTALIRQLYSPVRWTE
TVEKMAQDGVEVLV

KEGG   T30302 (Metagenome): 12211
Entry
12211             CDS       T30302                                 

Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
vpr:Vpar_0698 (best score: 154.451)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.12211-T1-C
LinkDB
Position
C469249:166..411
AA seq 82 aa
MKTAFVFPGQGSQKVGMLKDLYEAYPIVRERFAQADEALGYSISQLCFEGPDTELVKTAN
TQPAILTASVACYEILKEKGFT

KEGG   T30302 (Metagenome): 13550
Entry
13550             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
cad:Curi_c16330 bmar:HF888_07525 (best score: 43.8986)
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.13550-T1-C
LinkDB
Position
C472223:3..215
AA seq 70 aa
SPVNWIKVIETLSLDVDGIFEVGPGKTLTKFNKNILKKNKVDNIYLGHVENTDTLNLEIG
KILYEDSKFE

KEGG   T30302 (Metagenome): 14708
Entry
14708             CDS       T30302                                 

Definition
malonyl-coA-[acyl-carrier-protein] transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
hin:HI0156 (best score: 276.944)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.14708-T1-C
LinkDB
Position
C474629:complement(2..445)
AA seq 148 aa
MKKFAMVFPGQGSQAVGMLADLANEYPVVTETFKQASEALGYDLWNLVQQGPAEELNKTW
QTQPALLAASVAIFRVWQEKYPQLQPSVMAGHSLGEYSALVCAGVIDFKDAIKLVELRGK
LMQQAVPEGTGAMYAIIGLDNEAIINAC

KEGG   T30302 (Metagenome): 16647
Entry
16647             CDS       T30302                                 

Gene name
fabD
Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
hin:HI0156 (best score: 343.584)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.16647-T1-C
LinkDB
Position
C478523:complement(1..534)
AA seq 178 aa
MKKFAMVFPGQGSQTVGMLADLATEYPIVTETFKQASDELGYDLWHLVQQGPAEELNKTW
QTQPALLAASVAIYRVWQAKFPQLKPEVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGK
LMQQAVPEGTGAMYAIIGLDNEAIINACKQAEEGEVVSAVNFNSPGQVVIAGAKAAVE

KEGG   T30302 (Metagenome): 18045
Entry
18045             CDS       T30302                                 

Definition
malonyl-coA-[acyl-carrier-protein] transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
aap:NT05HA_1505 (best score: 72.0182)
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.18045-T1-C
LinkDB
Position
C481119:1..141
AA seq 46 aa
QDGVEVLVEIGPGKVLNGLTKRIVAELQATSVNDVASLDAVEALLA

KEGG   T30302 (Metagenome): 19108
Entry
19108             CDS       T30302                                 

Definition
acyl-carrier-protein S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
top:TOPB45_0674 (best score: 93.2041)
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19108-T1-C
LinkDB
Position
C482927:306..845
AA seq 180 aa
MIIGLVFPGQGCQYDKMGLDFIDSSEESMKFCKSVEEYTSVKVIDLLTDVAKIDEFSQLR
IIVAEILTYYAFQSKINGSEIKIKYTGGHSLGEYSALYVSGILSLSELLNLVMFRNKVIQ
FNQFPEKTSMIAVTDSDISNINKSISQLNIKNLFPSNINSYKQIVYSGSISAINHLQEKL

KEGG   T30302 (Metagenome): 19873
Entry
19873             CDS       T30302                                 

Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
raj:RA11412_1621 (best score: 155.992)
Taxonomy
Actinobacteria [GN:raj]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.19873-T1-C
LinkDB
Position
C484155:1..339
AA seq 112 aa
AGAFHTEAMAPAVEPLKKFADTITVEDPKHKILSNRDGSAVASGQEFLDSLVKQVTNPVR
WDLCMAQMLQDEVTDIIEVTPAGTLVGLAKRAMRGVPFTAINAPEDLEKFGA

KEGG   T30302 (Metagenome): 20183
Entry
20183             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
vpr:Vpar_0698 (best score: 261.151)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.20183-T1-C
LinkDB
Position
C484649:2..550
AA seq 182 aa
AAILALPREDVVRICGEVNDTVGSVQAVNFNCPGQIVIAGATKAVEVAAEKMKEAGAKRA
VMLPVSAPFHSRLMEPAAKRLQEELDNIEVKDAQIPVVANITGEILKDGAAIKAALVKQA
AAPVLWEDCVATMVDFGATRFVEVGPGKVLTGFTKKINKAMELANVEDEASLAAAIAFLQ
GE

KEGG   T30302 (Metagenome): 22345
Entry
22345             CDS       T30302                                 

Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
rmu:RMDY18_11750 (best score: 171.785)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.22345-T1-C
LinkDB
Position
C487463:1469..1780
AA seq 104 aa
MYAIVCPGQGSQKKGFLTPWLEIVGVREHLECLSQAAELDLIHYGTEAEEEAIKDTAIAQ
PLIVAAGIVTGRLTLARLGSENLLFAGHSVGEITAAALSGILSD

KEGG   T30302 (Metagenome): 2815
Entry
2815              CDS       T30302                                 

Definition
acyl carrier protein S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
hin:HI0156 (best score: 256.529)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.2815-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2846:complement(1329..1754)
AA seq 141 aa
GAKAAVERAAALCKDAGAKRALPLAVSVPSHCALMKPTAEQLAVTLENIQINTPTTSVLN
NVDVKAETEGTEIRTALIRQLYSPVRWTETVEKMAQDGVQALVEVGPGKVLNGLAKRIVG
DLQAISVNDVASFNAVEEFLA

KEGG   T30302 (Metagenome): 4540
Entry
4540              CDS       T30302                                 

Gene name
fabD
Definition
[acyl-carrier-protein] S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Best hit
lla:L0184 (best score: 134.42)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.4540-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4308:complement(3..269)
AA seq 89 aa
MTKTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRHLIDTEEDKLNKTRY
TQPAILATSVSIYRLLQEKGYKPDMVAGL

DBGET integrated database retrieval system