KEGG   T30302 (Metagenome): 12066
Entry
12066             CDS       T30302                                 

Gene name
rpiB
Definition
ribose-5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Best hit
esi:Exig_2695 (best score: 179.874)
Taxonomy
Firmicutes - Bacilli [GN:esi]
Pathway
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12066-T1-C
LinkDB
Position
C468931:2..376
AA seq 124 aa
LEKQGIEYKDFGTYSTDSMDYPDVAKPLAEAVAAGEFDRGILTCGTGIGIGIAANKVKGV
RAALCHDTFSAHASREHNNANVLTMGERVIGQGLALDIVDIWLHTEFEGGRHAKRVDKIS
AIEE

KEGG   T30302 (Metagenome): 6529
Entry
6529              CDS       T30302                                 

Definition
galactose-6-phosphate isomerase, lacA subunit
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Best hit
thl:TEH_04470 thl:TEH_24180 (best score: 51.9878)
Pathway
00030  Pentose phosphate pathway
00051  Fructose and mannose metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6529-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5721:986..1120
AA seq 45 aa
MKVILATDQDGFQLKETVKHYLLHSGYEVIDLNSTQGSEDFVDST

DBGET integrated database retrieval system