KEGG   T30302 (Metagenome): 12334
Entry
12334             CDS       T30302                                 

Definition
P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Best hit
lgo:JCM16774_0947 (best score: 158.303)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12334-T1-C
LinkDB
Position
C469537:complement(1..414)
AA seq 138 aa
RDSTDLIKDKNIHIVGEVRHRISHSLLGIPGASLDTIQEVYSHEQALMQCSQFLATHSSW
QLAPMNNTAMSAKYVNETQDITKACIANASAKELYGLTLLASDIANFKENFTRFFIITHK
DVVIHDAHKLSIIVQTSN

KEGG   T30302 (Metagenome): 14920
Entry
14920             CDS       T30302                                 

Gene name
pheA
Definition
P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Best hit
hin:HI1145 (best score: 310.457)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14920-T1-C
LinkDB
Position
C475081:complement(25..513)
AA seq 162 aa
ERVHIEYCESSSHAMQLVSSLNKPNIAALGNEDGGKLYGLNVLKTNIANQENNITRFIVV
AKTPREVSSQIPTKTLLLMTTSQQVGSLVDALLVFKKHHINMTKLESRPIYGKPWEEMFY
LEIEANIHHPDTQQALEELKNYSNYLKILGCYPSEIVKPVNI

KEGG   T30302 (Metagenome): 16110
Entry
16110             CDS       T30302                                 

Gene name
pheA
Definition
P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Best hit
hin:HI1145 (best score: 224.172)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16110-T1-C
LinkDB
Position
C477485:213..578
AA seq 122 aa
MALELSEIRQQITQIDRSLLKLLSERHRLAFDVVRSKEVTQKALRDVEREQALLQELIQF
AENENYQLEAQYITSIFQKIIEDSVLTQQVYLQNKLNEQRSQNLHIAFLGKRGSYSNLAA
RN

KEGG   T30302 (Metagenome): 5352
Entry
5352              CDS       T30302                                 

Gene name
pheA
Definition
P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Best hit
paet:NCTC13378_01307 (best score: 411.764)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5352-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4983:2688..3407
AA seq 240 aa
MALDLSEIRQQITQIDRSLLKLLSERHRLAYDVVRSKEVMQKALRDLEREQQLLQELVQF
AESQNYQLEPQYITAVFQKIIEDSVLTQQVYLQKKLNEQREETLHIAFLGKRGSYSNLAA
RNYAARYHQQFAEISCDSFAQIFEKVESGEADYGVLPLENTTSGAINEVYDLLQHTNLSL
VGELAYPIKHCVLVNEQDDLSKIDTLYSHPQVIQQCSQFIQSLERVHIEYCESSSHAMQL

KEGG   T30302 (Metagenome): 8883
Entry
8883              CDS       T30302                                 

Gene name
pheA
Definition
P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Best hit
hin:HI1145 (best score: 213.001)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8883-T1-C
LinkDB
Position
C461478:complement(3..329)
AA seq 109 aa
SNLAARNYAARYQKQFIELGCQSFEQVFEKVQNGEADFGILPLENTTSGAINEVYDLLQH
TELSLVGELAYPIKHCVLVNDMTDLSQIDTLYSHPQVIQQCSQFIHSLE

DBGET integrated database retrieval system