KEGG   T30302 (Metagenome): 12690
Entry
12690             CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
vpr:Vpar_1533 (best score: 152.525)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.12690-T1-C
LinkDB
Position
C470357:complement(1..417)
AA seq 139 aa
MSSAQDLRKRIKSVTNTQQITKAMKMVASARLRRAQQKAKGTEPYTERLRHMLHQSMSSL
DGSADLPLLTVRPVNKVAYVVVGADKGLAGAYTSNIIKYVQSLLKDTPTDAYGLFTVGRK
PTEYFRGHGYSVVSELQGF

KEGG   T30302 (Metagenome): 16909
Entry
16909             CDS       T30302                                 

Gene name
atpG
Definition
ATP synthase F1, gamma subunit
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
hin:HI_0480 (best score: 392.889)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16909-T1-C
LinkDB
Position
C479035:2..604
AA seq 200 aa
GLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLSGLGDTPALEEL
IGVANTMFDAYRNGEIDAVYIAYNKFVNTMSQKPVVQQLVPLPESKDDHLNERQQTWDYL
YEPEPKVLLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNK
ARQASITNELNEIVAGAAAI

KEGG   T30302 (Metagenome): 8020
Entry
8020              CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
got:AXE85_07445 (best score: 184.496)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.8020-T1-C
LinkDB
Position
C459400:complement(1..312)
AA seq 104 aa
MQKMQEVMGTIFGKSSSIKHPMLEKREAKKTLYVVITSDSGLCGGFNSNVIRNFVNTVNE
RHANSEYGIVAIGNYGAEFFRKNGYNVVDSYRDIPDEPSFTQVK

KEGG   T30302 (Metagenome): 5152
Entry
5152              CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
hin:HI_0480 (best score: 170.244)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5152-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4835:complement(3..266)
AA seq 88 aa
MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKAS
VGYKHPFLVEREVKKIGILVISTDRGMC

KEGG   T30302 (Metagenome): 12136
Entry
12136             CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
rpne:NCTC8284_00249 (best score: 234.958)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.12136-T1-C
LinkDB
Position
C469087:complement(28..408)
AA seq 126 aa
EVDAVYIAYNKFVNTMAQKPVYQQLIPLPALETDNLEKRQSTWDYLYEPEPKVLLDSLLT
RYLESQVYQSVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIV
AGAAAI

KEGG   T30302 (Metagenome): 13588
Entry
13588             CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
rpne:NCTC8284_00249 (best score: 279.641)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13588-T1-C
LinkDB
Position
C472303:3..455
AA seq 151 aa
TKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKATVGYKHPFLIQREVKRVGILV
VSTDRGMCGGLNINLFKTVMTEIKQWKDKGVTVELGLIGSKGISFFRSLGLPVRAQLSGL
GDNPTMEDLIGVANGMFGSYKDGEVDAVYIA

KEGG   T30302 (Metagenome): 13864
Entry
13864             CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
rmu:RMDY18_12850 (best score: 226.868)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13864-T1-C
LinkDB
Position
C472875:3..467
AA seq 155 aa
AMEMIATSRINKARRSAQTTGPYANALTRVVTALATQQSVQHPLIHRPDTFGKHEHKRSA
VLVMTSDRGLAGSYSSSVLKKTEELIERLRGEGREIQLYLVGRKAKSYFEFRERPYERAW
EGHTDNPHIDTAVEIRDVFLEEYEKGHENGGVDDL

KEGG   T30302 (Metagenome): 20102
Entry
20102             CDS       T30302                                 

Gene name
atpG
Definition
H(+)-transporting two-sector ATPase
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Best hit
rmu:RMDY18_12850 (best score: 238.039)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.20102-T1-C
LinkDB
Position
C484513:complement(566..994)
AA seq 142 aa
GGVDDLHIVYTEFKSMVTQETKILRLLPIHVAEATKLGEEIVPDEELSSADYQQPASFEF
EPSPQEVLDALLPRYIASRIFACLLQAAASELASRQRAMKTAGDNAETLIKKYTRLMNNA
RQAEITQELSEIVGGADALASS

DBGET integrated database retrieval system